KEGG   Stylophora pistillata: 111341720Help
Entry
111341720         CDS       T05774                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
spis  Stylophora pistillata
Pathway
spis03030  DNA replication
spis03410  Base excision repair
spis03420  Nucleotide excision repair
spis03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spis00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111341720
   03410 Base excision repair
    111341720
   03420 Nucleotide excision repair
    111341720
   03430 Mismatch repair
    111341720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spis03032]
    111341720
   03400 DNA repair and recombination proteins [BR:spis03400]
    111341720
Enzymes [BR:spis01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111341720
    6.5.1.6  DNA ligase (ATP or NAD+)
     111341720
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111341720
DNA replication proteins [BR:spis03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111341720
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111341720
DNA repair and recombination proteins [BR:spis03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111341720
   NER (nucleotide excision repair)
    Other NER factors
     111341720
   MMR (mismatch excision repair)
    Other MMR factors
     111341720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 111341720
NCBI-ProteinID: XP_022804444
LinkDB All DBs
Position
Unknown
AA seq 1036 aa AA seqDB search
MAQRGITAFFSPCAKTKSKEKNEEKVASNGDIKVKEERTPLKFKPQTAALDSPPVKKTRK
QKSRRILDDTSDEENDTKDFVPSKQDQHVDILKQDTLSQEVAETEHCETGDTKEERKFIE
VRSPQNEMMHIPKRKTALRKPAKRKASSEEESTVENQAKAVKRAKPEQDSEEKQRENLDK
AGKPANDKVKREKVDRGLNFVNNGDGDKDEAFVKCGKDQTAGGSESKGRKKRREREEENG
KQSTETKEDTGEGKLKKKTNLKKNFKSDGTKGEKDDMKLQSSKHNETKEQSKSIKESGEE
DSEVEIKKEKGEDVSSHRDSKGVNKAKGAFIDFFSPKRSKKGESNNEKLTEKSKSDRDNP
STKKTSSSNKTGLSELVKPTEYSPEKSDYHPIQNACWRHGERVPYLAVAKTFHAIEDTSA
RLKITSILSNFFRSVIVLSPEDLLPCVYLCLNKLAPAYEGIELGIGENILMKAVAESTGR
SLQQIKYDVGEKGDLGIVAESCRSTQRTMFAPPKLTASSVFTKLKEIAMMTGHSSMTRKS
EKIKGMFVACRDAEARYLIRSLGGKLRIGLAEQSVLTALGHAVFLTPPSKEFPSPIIDNA
KNFSGDGLKKKQDEAALIVKTCYCEMPSYNKLIPSLLEHGLETLPEHCHLTPGIPLKPML
AHPSKGVEEVFKRFEDAAFTCEYKYDGERAQIHVLESGEIHIYSRNQEDNTSKYPDIIER
MPKVLGDKVKSCIIDAEAVAWDREKKQILPFQILSTRKRKDANASDIKVQVCVYAFDLLY
LNGKSYIKETFQKRREALRSSLVEVEGEFMFAQSSDSINADDIAEFLDNSIKGNCEGLMV
KTLDMDATYEIAKRSHNWLKLKKDYLNGVGDTLDVVVIGGYLGKGKRTGSYGGYLLACYD
PENEEFQTICKIGTGFTDELLDKHYQFFKDQVIPHPKAYYRYDDNLAPDHWFVPVQVWEI
RAADLSVSPVHKAALGLVDPVKGISLRFPRFLRIRDDKKPEQATDSSQVAEMYRSQETVK
NNANPPPTTDASDDFY
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaagaggaataactgcattcttttctccgtgcgcgaaaacaaagagtaaagaa
aagaacgaagaaaaagtggccagtaatggagacatcaaggtgaaagaggaaaggacccca
cttaagttcaaaccacaaactgcagctttagattcacctcctgtcaaaaagactcgcaaa
caaaaatcacgccgcatacttgatgatactagcgatgaagaaaatgatacaaaagatttt
gtgccatctaagcaagatcaacatgttgatatcctgaaacaagatactctatcgcaagaa
gttgctgaaacagaacattgtgaaactggtgatactaaggaagaaagaaaatttatagaa
gtcaggtctccacaaaatgagatgatgcatattcctaaaagaaagacagcattaagaaaa
cctgccaaaaggaaggcctcaagtgaggaggaatctacagtggaaaatcaggccaaggct
gtaaaaagagcaaagccagaacaggattctgaggaaaagcaaagagaaaatcttgacaag
gcggggaaacctgctaatgataaagtgaaaagagaaaaagtagacagaggattaaacttt
gttaataatggtgatggagacaaggatgaggcttttgttaagtgtgggaaagatcaaaca
gcagggggatcagaatctaagggtagaaagaaacgaagagaaagagaggaagaaaatggc
aaacaatcaacagagacaaaagaagacactggagaaggaaaactgaagaaaaaaacaaat
ctgaagaaaaatttcaaaagtgatggaactaaaggtgaaaaagatgacatgaagctgcaa
agctcaaaacacaatgaaacaaaagaacagagtaagtctattaaggaaagtggagaagaa
gattctgaggtggagataaagaaggagaagggagaagatgtatccagccatcgagactcc
aagggtgtaaacaaggctaagggtgcattcattgacttcttctctcctaaacggtccaaa
aagggagaaagtaacaatgaaaaacttacagagaagagtaaaagtgacagagacaatcca
tcaacaaagaaaacaagctcttcaaataaaactgggctcagtgaacttgtgaagcccact
gaatattctccagaaaaaagtgactatcaccccatccaaaatgcctgttggagacatgga
gaaagagttccttacttggctgtagccaaaacatttcatgccatagaagacacttcagcc
aggttgaaaattacctccatcctcagcaacttcttccgttcagtgattgttctttctcca
gaagatctccttccatgtgtttatctctgtcttaataagctggctccagcatatgaggga
attgaacttggaattggagagaacattctaatgaaagcagttgcagagtcaacaggacga
agccttcaacagataaagtacgatgttggagaaaagggagatttgggaatagtagctgag
agttgccgaagcacccagcgcaccatgtttgccccacctaagctaactgcttcaagtgtc
tttaccaaactgaaagaaattgcaatgatgacaggacatagttctatgacaagaaagtca
gagaaaatcaaaggcatgtttgtagcttgtcgtgatgcagaagcaagatatttaatcaga
tctttagggggcaagttaagaattggtcttgctgaacaatcagttttaacagcccttgga
catgcagtctttctcacccctccaagtaaagagttcccttcccctattattgacaatgct
aagaatttttctggtgatgggctgaaaaagaaacaagatgaggcagctttaattgtaaag
acctgctactgtgaaatgcccagctataacaaactgattccatcacttctggaacacgga
ctagaaacacttccagaacactgtcatctaacaccaggtattccactgaagccaatgctg
gctcatccttccaaaggagtggaagaagtgtttaaaagatttgaggatgcagcattcaca
tgtgaatataagtatgatggagaacgagctcagatccacgtactagaaagtggagaaatt
cacatttacagccgaaaccaggaggacaacacatcaaagtatcctgacattattgagaga
atgccaaaagttttaggtgataaggtcaagtcctgcatcattgatgctgaagctgtggcg
tgggaccgagagaagaaacagattctgccttttcagattcttagcacacgtaaaagaaag
gatgccaatgcctcagatataaaagttcaagtttgtgtctatgcatttgatttattatat
ttgaatggaaagtcatacatcaaggaaacatttcaaaagcgtagagaagctctccgatca
tcactcgtagaagttgagggggagttcatgtttgctcagagttctgattcaataaatgca
gatgatattgcagaattcttggataattcaatcaaaggtaattgtgagggtctgatggtt
aaaacccttgacatggatgccacatatgaaattgctaaacgttcacataattggttgaag
ttgaagaaagactacctaaatggtgttggagatactttagatgtagttgtcattggaggt
tatctgggtaaaggcaaaagaactggctcatacggtggatacctgctagcctgctatgat
cctgagaatgaagaattccaaactatctgtaagattggaactggttttacagatgagcta
cttgacaaacattaccagttttttaaagatcaagtgattccacatccaaaggcatattat
cgctatgatgataatctggctcctgatcattggtttgtcccagttcaggtttgggaaatc
agagcagcagatctttcagtctctcctgttcataaagcagctttgggcctggttgatcct
gtcaagggaatatcgctgcgatttccacgctttttgaggatccgagatgataagaaacct
gaacaagccacggacagctcacaggttgcagaaatgtacagaagccaagaaactgtgaag
aataatgcaaatcctccaccaactacagacgcttctgatgacttctattga

DBGET integrated database retrieval system