KEGG   Sphingomonas sp. KC8: KC8_04980
Entry
KC8_04980         CDS       T04987                                 

Definition
(GenBank) signal transduction histidine kinase
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
spkc  Sphingomonas sp. KC8
Pathway
spkc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spkc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KC8_04980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spkc01001]
    KC8_04980
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:spkc02022]
    KC8_04980
Enzymes [BR:spkc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     KC8_04980
Protein kinases [BR:spkc01001]
 Histidine kinases
  OmpR family
   KC8_04980
Two-component system [BR:spkc02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   KC8_04980
SSDB
Motif
Pfam: HATPase_c Sensor_TM1 HisKA HAMP Stimulus_sens_1 HATPase_c_2 Ferritin Rnk_N
Other DBs
NCBI-ProteinID: ARS26642
UniProt: A0A1X9YCR1
LinkDB
Position
1025771..1027345
AA seq 524 aa
MAWGIALRKSDERDLALMWSKRWSLTTRILAVNIFALAMLAGGFFYLDSYRAKLIDARLE
QTATQAHLIADALDAVPADGQPALLEKLEQTSGLRLRVYDHTGARMLDSWSQGAPTYQLR
DPGEEGWQRQAARFLDRAIDVIVGADKPERFVEPARDTLAAWPEALAARASGRPETVMRR
APDRTPVISAAAPMHDNGMTLLTTTNARDIVRIVRAERLRLGIVLAMVISVSVLLSLFLA
RTIVRPLRRLARAAHRVRLGRAREVQVPRLPSRRDEIGLLARALSDMSLALRQRIDATEA
FAADVTHELKNPLASLRSAVETLEKVKDPALQDQLLDVVRDDVHRLDRLITDIADASRLD
AELSRARFETIDLGQMIEGLVDAREKRGTSSGVRLAFARPHAGSAVVHGDGSRLTRVIEN
LVDNAISFSPPGGLVKIAATRDGDEIVCRIDDEGPGVAPEVREAIFKRFHSIRPEGEAFG
QHSGLGLAIAKAIVEAHNGTIMVQDRDDAPSGARFIIRLPVAER
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggcgtggggtatcgctttgcggaagagtgatgagcgcgatctcgcgctgatgtggtcg
aagcgctggtcgctgacgacgcggattctggcggtcaatattttcgcgctggccatgctg
gcgggtggcttcttctatctggacagctaccgcgccaagctgatcgacgcgcgtctggaa
cagaccgccacacaggcccacctgattgccgacgcgctggatgccgtgcccgccgatggc
cagccagccctgctcgaaaaactcgaacagacgagcgggctgcgcctgcgtgtctatgac
catacaggcgcacgcatgctcgacagctggtcgcaaggcgcccccacctatcagctgcgc
gatccgggggaggaaggctggcagcgtcaggcggcccggttcctggacagggcaatcgac
gtcatcgtcggcgcggataagccggaacggttcgtcgaaccagcccgtgacaccctggcc
gcatggcccgaagcgctggccgcccgtgcctccggccgccccgaaacggtgatgcgtcgg
gcgcccgatcgcacgccggtgatttcggcggcagccccgatgcacgataatggcatgacg
ctgctcaccacgacaaatgcgcgcgatatcgttcgcatcgtccgcgccgaacggctgcgg
ctgggcatcgtgctggcgatggtgatcagcgtgtccgttctgctgtcgctgtttctggcg
cgcaccatcgtccggcctttgcgcaggctggcgcgcgccgcacaccgtgtccgtctgggc
cgtgcgcgcgaagtgcaggtgccccgcctgccatcgcgtcgcgatgaaatcggcctgctc
gcccgcgccttgtcggacatgagcctcgcgctgcgccagcggatcgacgcgaccgaagcc
ttcgcggccgacgtcacgcatgaattgaaaaaccccctcgcctcgctgcgttcggcggtc
gagacattggaaaaggtgaaggatccggcgcttcaggatcagttgctcgatgtggtccgc
gatgatgttcaccggctcgatcgcctgatcaccgacatcgccgatgcgtcccggcttgat
gccgaactgtcgcgcgcgcgtttcgaaaccatcgatctgggccagatgatcgaaggcctt
gtcgacgcgcgtgaaaagcggggcaccagttccggcgtacggctggcctttgcccgcccg
catgccggatccgccgtcgtgcacggcgatggttcgcgattgacccgcgtcatcgaaaac
ctggtcgacaacgccatcagcttttcgccgccgggcggcctggtgaagatcgcggccacc
cgcgacggcgacgaaatcgtctgccggatcgatgatgaggggccgggcgtcgccccggaa
gtgcgcgaagcgatcttcaagcgatttcacagcatccggccggaaggcgaagctttcggc
caacatagtggcctgggcctcgctatcgccaaggcgattgtcgaggcgcataatgggacg
atcatggtacaggaccgcgacgatgcgccatcgggcgcccgcttcatcatccgcctgccg
gtagccgaacgatga

DBGET integrated database retrieval system