KEGG   Shewanella pealeana: Spea_2422Help
Entry
Spea_2422         CDS       T00606                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spl  Shewanella pealeana
Pathway
spl00473  D-Alanine metabolism
spl00550  Peptidoglycan biosynthesis
spl01100  Metabolic pathways
spl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Spea_2422
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Spea_2422
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Spea_2422
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spl01011]
    Spea_2422
Enzymes [BR:spl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Spea_2422
Peptidoglycan biosynthesis and degradation proteins [BR:spl01011]
 Precursor biosynthesis
  Amino acid ligase
   Spea_2422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp RimK
Motif
Other DBs
NCBI-ProteinID: ABV87742
UniProt: A8H5A5
LinkDB All DBs
Position
2960862..2961866
Genome map
AA seq 334 aa AA seqDB search
MTQKNLLLLCGGGGDEHSISLLSANFFEAQLATLPHFNVLRVELNAKGQYHTQAGELCEL
TNSQQLRFDDETKAPWNVDYVIPCIHGYPGETGDIQSYFELINLPYFGCDSESSSNCFNK
VTAKMWFSALGIPNTPYIFLSEFNQQSLEQAEAALAKWGSIFIKAASQGSSVGCYRVDSI
EQLASSLEEAFTFSPYVVIEKTITARELEVAAYEADGEIIATKPGEIICASNTFYSFDEK
YAENSQAQTVIEADVDEAIAKQIQEYAIKAFKGMKLRHLSRIDFFLTEDNEILLNEINTF
PGQTQISMFPKMLQNHGHNFAQYLSGNILAQLKS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaagaatttattattgttgtgtggtggtggcggtgatgagcacagtatctca
ctcttatcggccaacttttttgaagcgcaactcgccactttgccacactttaatgtgctg
cgcgttgaactcaatgctaaaggtcaatatcacacccaagcgggcgagctttgcgagcta
accaatagccagcagctccgctttgatgatgagaccaaagccccatggaatgtggactat
gtgatcccttgtattcacggctacccaggtgagacaggtgacatccagtcctattttgaa
ttgattaacctaccctattttggctgtgactcagaatcaagcagcaactgcttcaataaa
gtcaccgctaagatgtggtttagcgctcttgggatccccaatacgccttatattttctta
agcgaatttaatcagcaatctttggaacaagccgaggctgcattggcaaaatgggggtct
atctttattaaagccgcctcacagggctcatctgtcggttgttaccgcgtcgatagcata
gagcagctagcaagctcattagaggaggcatttaccttctcgccatatgtggtgatcgag
aagacaattaccgcccgtgaattagaggtagccgcctatgaagccgatggtgaaatcatc
gcgaccaaaccgggtgaaattatctgcgctagcaatactttctatagcttcgatgagaag
tatgcagaaaacagccaagcacagactgtgattgaagctgatgttgatgaggcaattgcc
aagcaaattcaagaatatgcgattaaagcgtttaaggggatgaagttacgtcacctatcg
agaatcgacttcttcttaaccgaagacaatgaaattttgcttaatgagatcaacacattc
ccaggtcaaacgcagatatctatgttccctaagatgctacaaaatcatggacataatttt
gctcagtatctttcaggtaatattttggcgcagttaaaaagttaa

DBGET integrated database retrieval system