Sphingomonas sp. LM7: BXU08_01445 Help Entry BXU08_01445       CDS       T04824                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism splm  Sphingomonas sp. LM7 Brite KEGG Orthology (KO) [BR:splm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:splm03032]     BXU08_01445    03036 Chromosome and associated proteins [BR:splm03036]     BXU08_01445    03400 DNA repair and recombination proteins [BR:splm03400]     BXU08_01445 DNA replication proteins [BR:splm03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BXU08_01445 Chromosome and associated proteins [BR:splm03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BXU08_01445 DNA repair and recombination proteins [BR:splm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BXU08_01445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 HU-CCDC81_euk_1 DUF2267 Glyco_transf_29 Motif Other DBs NCBI-ProteinID:  AQR75607 UniProt:  A0A1S6FQ12 LinkDB All DBs Position 314662..314934 Genome browser AA seq 90 aa AA seqDB search MNKQELIGTVADTSGLGKGDATKAVEAVFDAISTALKKGDEVRLVGFGTFSVSKRKASTG RNPRTGEEMTIKASNQPKFKAGKGLKDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagcaagagctgatcgggacggtcgccgacacctcgggcctcggcaagggcgac gccaccaaggccgtcgaggccgtgttcgacgcgatctcgactgcgctcaagaagggtgat gaggttcgcctcgtcggcttcggcacgttctcggtgagcaagcgcaaggcatcgacgggc cgcaatccccgcaccggcgaggaaatgacgatcaaggcgtcgaaccagcccaagttcaag gccggcaagggcctcaaggattcggtcaactga

DBGET integrated database retrieval system