KEGG   Sphingomonas sp. LM7: BXU08_19135Help
Entry
BXU08_19135       CDS       T04824                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
splm  Sphingomonas sp. LM7
Brite
KEGG Orthology (KO) [BR:splm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BXU08_19135
Enzymes [BR:splm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BXU08_19135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored NAD_binding_7 DAO FAD_binding_3 AlaDh_PNT_C Glutaredoxin K_oxygenase Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AQR75488
UniProt: A0A1S6FPL2
LinkDB All DBs
Position
complement(4056094..4057674)
Genome map
AA seq 526 aa AA seqDB search
MLDANLTQQLKTYLVNIKQPIELVASLGDDAKSGELERLLNDIAALSDDITVVRKDDARK
PSFMIRRTGTDIGVRFAGLPMGHEFTSLVLALLQVGGHPSRATQELIDQVKDLDGDYAFE
TYFSLSCQNCPDVVQALNLMAVLNPRIKHVAIDGALFKDEVDSRKVMAVPTVFLNGEPFG
QGRMELEQIVAKIDSGAEARAAEKIKTKDAFDVLVVGGGPAGAASAIYAARKGIRVGVAA
ERFGGQVLDTMAIENFISVPHTEGPKLAAHLEQHVKDYDVDIMNLQRAEKLIPARTEGGL
HEVVLANGASLKARTLILSTGARWRQMGVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEYDSDLRADAVLQRKLATLPNVKVITSALTTEVRGDGE
KVSGLVYKDRNHGTEHQIELEGIFVQIGLVPNTEWLKDSVALSNRGEIEIDARGETSQRG
IFAAGDATTVPYKQIVIAMGAGSTAALSAFDYLIRLPEDVLVEAAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctgacgcagcagctcaagacctatctggtcaacatcaagcagccg
atcgagctggtcgccagcctgggcgacgatgccaagtcaggcgagctcgagcggctgctc
aacgacatcgccgcactctccgacgacatcacggtcgtgcgcaaggacgatgcccgcaag
cccagcttcatgatccgccgcaccggcaccgatatcggcgtgcgcttcgcggggctgcca
atggggcatgaatttaccagccttgtgctcgcgctgctgcaggttggcgggcacccgtcg
cgcgcgacgcaggagctgatcgaccaggtcaaggacctcgacggcgattacgcgttcgag
acctatttctcgctgtcgtgccagaactgccccgatgtggtccaagcgctcaatttgatg
gcggtgctcaatccgcgcatcaagcacgtcgcgatcgacggcgcgctgttcaaggacgaa
gtcgacagccggaaggtgatggctgtgccgacggtgttcctcaacggcgagccgttcggg
cagggccggatggaactcgagcagatcgtcgcgaagatcgacagcggcgccgaggcgcgc
gcggccgagaagatcaagaccaaggatgcattcgacgtattggtggtcggcggcgggccc
gcgggggcagcgtcggcgatctatgcggcgcgcaagggtatccgcgtgggcgtggcggcc
gagcgtttcggcgggcaggtgctcgacacgatggcgatcgagaacttcatctcggtgccc
cacaccgagggccccaagctcgccgcgcatctggagcagcacgtcaaggactatgacgtc
gacatcatgaacctgcagcgggccgagaaattgatcccggcgcggaccgagggcggactg
cacgaagttgtgctggccaatggcgcgagcctcaaggcgcggacgctgatcctgtcgacc
ggggcgcgctggcggcagatgggagttccgggcgaggatcagtatcgcaacaagggcgtg
gcctattgcccgcattgcgacggcccgctgttcaagggcaagcgcgtcgcggtgattggc
ggcggcaattcgggtgtggaagccgcgatcgatcttgccgggatcgtcgcgcacgtcacg
ctgatcgaatatgacagcgacctgcgcgccgacgcagtgctccagcgcaagctggcgacc
ttgcccaacgtcaaggtgatcacgtcggcactgaccaccgaagtgcgcggcgatggcgag
aaggtgtccgggctggtctacaaggaccgcaaccatggcaccgagcatcagatcgaactg
gaaggcatcttcgtccagatcgggctggtgccgaataccgaatggctcaaggattcggtc
gcgctgtcgaaccgcggcgaaatcgagatcgatgcgcggggggagacttcgcagcggggt
attttcgccgcgggcgatgctacgacggtgccgtacaagcagatcgtgattgcgatgggt
gcaggctcgaccgcggcgctgtcggcgttcgactacctgatccggttgcccgaggacgtg
ctggtcgaagccgcggcgtga

DBGET integrated database retrieval system