KEGG   Streptomyces pluripotens: LK06_022085Help
Entry
LK06_022085       CDS       T04845                                 

Definition
(GenBank) hypothetical protein
Organism
splu  Streptomyces pluripotens
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ARP74357
UniProt: A0A221P981
LinkDB All DBs
Position
4902723..4903802
Genome map
AA seq 359 aa AA seqDB search
MKVLLHRHRELCRRAVDPLEIAAGLEAHGVTDRTAARFRHRDVFSLAEELYARVPRDADP
RPETDPLPVPRVHAGWVLLTLLPGALGAATVAGLRLTHGHPRLLVALGGIFAAALSTRTA
LRRGPLAGSPATRARWVAGGAYACTCWLLGYVLLGDGLLRAALAGGSDGLPAGAPHGPWP
TATAPVLALALSCAPAAWCAHLLTVGARRRLAGSRGLEDFATAAKPLLFGAFVLFLGALT
GLLLLCGAVLREPAAYPQALALGALLLLARLLTVHHHRYAAALALSAAVAVEAAALVLPL
AGRLPGCAFLAVPVQTLTDSWGEAAMPTLACGAAALALFLHATRTLTRASAHAPTGAPE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtcctgctccaccggcaccgtgagctgtgccgacgggccgtggacccgttggag
atcgccgccggactcgaagcgcacggggtgacggaccggaccgccgcccgcttccgccac
cgtgacgtcttctcgctcgcagaggagttgtacgcgcgcgtgccgcgggatgccgatccg
cgcccggagaccgatccactgcccgtgccccgcgttcacgccggctgggtgctgctcacc
ctcctgccgggtgccctcggcgcggcaaccgtggccggactgcgcctcacccatggacac
ccccgcctgctggtggccctcggcggcatcttcgccgccgcgctctccacccgcacggca
ctgcgccgcggcccgctggccggctctcccgccacccgtgcacggtgggtggcgggcggt
gcgtacgcgtgcacgtgctggctgctcgggtacgtccttctcggcgacggtctcctccgc
gcggcgctggccgggggctccgacggcctgcccgccggagccccccacggaccgtggccc
acggccaccgcgcccgtcctggccctcgccctgtcctgcgccccggcggcctggtgcgcc
catctcctcaccgtcggcgcccgtcgcagactcgccggcagccggggccttgaggacttc
gcgaccgccgcgaagccgctgctgttcggtgcgttcgtgctgttcctgggcgcgctcacc
ggtctgctcctgctgtgcggcgccgttctgcgcgaacccgcggcctacccgcaagccctc
gccctgggcgccttgctcctactcgcccgtctgctcaccgtgcaccaccaccggtatgcc
gccgccctggctctcagcgccgccgtggccgtcgaggccgcggccctggtcctgccgctc
gccggccggctgcccggctgcgcctttctggcggtccccgtgcagaccctgacggattcc
tggggagaggccgccatgccgacactcgcctgcggcgccgcggccctggccctgttcctg
cacgccacccgcacgctcacccgggcttcggcccacgcgcccaccggagcgcccgaatga

DBGET integrated database retrieval system