KEGG   Streptomyces pluripotens: LK06_022150Help
Entry
LK06_022150       CDS       T04845                                 

Definition
(GenBank) NrdH-redoxin
  KO
K18917  mycoredoxin [EC:1.20.4.3]
Organism
splu  Streptomyces pluripotens
Brite
KEGG Orthology (KO) [BR:splu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LK06_022150
Enzymes [BR:splu01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.3  mycoredoxin
     LK06_022150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin DUF836 GST_N_3 Thioredoxin Thioredoxin_2
Motif
Other DBs
NCBI-ProteinID: ARP72206
UniProt: A0A221P311
LinkDB All DBs
Position
complement(4924663..4924920)
Genome map
AA seq 85 aa AA seqDB search
MQGTVTMYSTTWCGYCRRLKSQLDREGIAYTEINIEQDPESAAFVEKANGGNQTVPTVRV
LPTSGGDEVVMTNPSLAQVKQALAV
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgcagggcactgtgacgatgtacagcacgacgtggtgcggctactgccggcggctgaag
agccagctggaccgggaggggatcgcctacaccgagatcaacatcgagcaggacccggag
tccgccgctttcgtggagaaggcgaacggcggaaaccagaccgtcccgaccgttcgggta
cttcccaccagcggtggcgacgaggtcgtcatgacgaacccgagccttgcccaggtgaag
caggctctcgcggtctga

DBGET integrated database retrieval system