KEGG   Serratia plymuthica PRI-2C: Q5A_010160Help
Entry
Q5A_010160        CDS       T04576                                 

Gene name
icd_1
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00020  Citrate cycle (TCA cycle)
sply00480  Glutathione metabolism
sply01100  Metabolic pathways
sply01110  Biosynthesis of secondary metabolites
sply01120  Microbial metabolism in diverse environments
sply01130  Biosynthesis of antibiotics
sply01200  Carbon metabolism
sply01210  2-Oxocarboxylic acid metabolism
sply01230  Biosynthesis of amino acids
Module
sply_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sply_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sply00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Q5A_010160 (icd_1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Q5A_010160 (icd_1)
Enzymes [BR:sply01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Q5A_010160 (icd_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANS42492
UniProt: A0A1B1KPX4
LinkDB All DBs
Position
2149514..2150767
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKQITVDAQGKLVVPNNPIIPFIEGDGIGVDVTPAMIHVVDAAVKKAYHG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYQGTPSPVKQPELTDMVIFRENAEDIYAGIEWKAGSAEADKVIKFL
RDEMGVKKIRFPEQCGIGVKPCSEAGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEG
AFKDWGYELAREEFGGELIDGGPWLKINNPNTGKEIVVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGSDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIVKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaaacagattacggtcgatgcccagggt
aaactggttgttccgaataacccgatcatcccgttcatcgaaggcgacggcattggcgtt
gacgttacccctgctatgattcacgtggttgatgcggctgtgaaaaaggcctaccacggc
gaacgtaaaatctcctggatggaaatctacaccggtgaaaaatccactcacgtttacggg
aaagacgtgtggctgccggaagaaaccctggatctgatccgtgactaccgcgttgccatc
aaaggcccgctgactaccccggtcggtggcggtattcgctccctgaacgtggctctgcgc
cagcaactggacctgtacgtgtgtctgcgtccggtgcgttactaccagggcacccctagc
ccggttaaacagccagagctgaccgacatggtgatcttccgcgaaaacgccgaagacatc
tacgcgggtatcgaatggaaagccggttctgccgaagcagacaaagtgatcaagttcctg
cgcgacgaaatgggcgtgaagaaaatccgcttcccggaacaatgcggtatcggcgtcaag
ccatgttccgaagcagggaccaagcgtctggtacgtgcggcgatcgaatacgccatcacc
aacgaccgtgactctgtgaccctggttcacaaaggcaacatcatgaagttcaccgaaggt
gccttcaaggattggggctacgaactggcgcgcgaagagttcggcggcgaactgatcgac
ggcggcccgtggctgaaaatcaataacccgaacaccggtaaagagatcgtggttaaagac
gtgatcgccgacgccttcctgcagcaaatcctgctgcgcccggcggaatacgacgtgatc
gcctgtatgaacctgaacggtgactacatctccgacgccctggccgcacaggttggcggt
atcggtatcgcaccgggcgccaacatcggttccgattgcgcgctgttcgaagcgacccac
ggcaccgcacctaagtatgccggccaggacaaagtgaacccaggttccatcatcctgtcc
gcagaaatgatgctgcgtcacatgggctggttcgaagcggctgacctgattgttaagggc
atggaaggcgccatcgctgccaagaccgtgacctatgacttcgaacgcctgatggaaggc
gctaaactgctgaaatgttcagagtttggcgacgctatcgttaaacacatgtaa

DBGET integrated database retrieval system