KEGG   Sphingobium sp. MI1205: K663_12310Help
Entry
K663_12310        CDS       T04383                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spmi  Sphingobium sp. MI1205
Brite
KEGG Orthology (KO) [BR:spmi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    K663_12310
Enzymes [BR:spmi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     K663_12310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored NAD_binding_7 HI0933_like FAD_binding_3 FAD_binding_2 DAO AlaDh_PNT_C Glutaredoxin NAD_binding_8 K_oxygenase FMO-like HTH_43 Thi4
Motif
Other DBs
NCBI-ProteinID: AMK18841
UniProt: A0A126R982
LinkDB All DBs
Position
1:2522056..2523639
Genome map
AA seq 527 aa AA seqDB search
MLDANLKGQLKAYMANITQPIELVASLDEGSKSREMESLLNEVAELSDKVSVVLTGNDKR
KPSFMIRRVGTDIGVTFAGIPMGHEFTSLVLALLQVGGHPSKAAQDVIEQIKDLDGDFTF
ETYFSLSCQNCPDVVQALNLMSVLNPRIKHVAIDGALFKEEVDARQVMAVPTVFLNGEPF
ASGRMELEQIVAKIDSGAAERAAEKIRKQEPFEVLVVGGGPAGAASAIYAARKGIRTGVV
AERFGGQVLDTMDIENFISVSRTEGPKLASALEAHVKDYDVKIMNLQQAAKLIPANSEGG
YHEVVLENGASLKGRTVILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVRIITSALTTKVEGDG
SRVTGLSYRDRNQGTDHDIELEGIFVQIGLVPNTEWLKDAVALSPRGEIEIDARGETSQP
GIFAAGDCTTVPYKQIVIAMGAGSTAALSAFDYLIRLPASVETAEAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcaaatctcaaaggccagttgaaggcctatatggcgaacatcacgcagccc
atcgagctggtggcgtcgctggacgaaggctcgaagtcgcgcgaaatggaaagcctgctg
aacgaagtcgccgaactgtctgacaaggtgtcggtggtgctgacgggcaatgacaagcgc
aagcccagcttcatgatccgccgcgtcggcacggacatcggtgtcaccttcgccggcatc
ccgatgggtcatgagttcacctcgctcgtcctcgccctgctgcaggtcggcggtcatccg
tcgaaggcggcgcaggatgtcatcgaacagatcaaggatcttgacggcgacttcacgttc
gaaacctatttctcgctgtcctgccagaattgccccgatgtcgtgcaggcgctgaacctg
atgagcgtccttaatccgcggatcaagcatgtcgccatcgatggcgcgctgttcaaggaa
gaggtcgatgcgcggcaggtcatggcggtgcctaccgtcttcctgaatggcgaacccttc
gccagcggccggatggagctggaacaaatcgtcgcaaagattgacagcggcgcggcggag
cgggcggcggaaaaaatccgcaagcaggaaccgttcgaggtgctggtggtcggcggcggt
cccgctggtgctgcctcggccatctatgcggcgcgcaagggcattcgcacgggcgtcgtg
gcggaacgctttggcggacaggtgctcgacaccatggatatcgagaatttcatctcggtt
tcccgcaccgaggggccgaaactggcttccgcgctggaggcgcacgtcaaggattatgat
gtcaagatcatgaaccttcagcaggcggcaaagctgatcccggcgaatagcgagggcggc
tatcatgaggtcgtgctggaaaacggtgcgtcgctgaagggccgcaccgttatcctgtcc
accggcgcccgctggcggcagatgggcgtgccgggcgaggacgaatatcgcaacaagggc
gtcgcctattgcccgcattgcgacggtcctctgttcaagggcaagcgtgtggcggtgatc
ggcggcggcaatagcggcgtcgaagcagccatcgacctggccggcatcgtcgcgcatgtg
acgctgatcgagttcgacagccagttgcgcgccgacgcggtattgcagcggaagctggcg
agcctgcccaacgtgcgcattatcacatcggccctgacgaccaaggtcgaaggcgacggt
tccagggtgacgggcctttcctacagggaccgcaatcagggcaccgaccatgatatcgaa
ctggaagggattttcgtgcagatcggcctggtccccaacaccgagtggttgaaggatgcg
gtcgccctttcccctcgcggcgagatcgagatcgatgccaggggcgagaccagccagccg
ggcatcttcgccgctggcgattgcacgaccgtgccctataagcagatcgtgatcgccatg
ggcgcgggttcgacggcggcgctgtccgcctttgattacctgatccgcctgcctgcgtcg
gtggagaccgcagaggcagcctga

DBGET integrated database retrieval system