KEGG   Sporosarcina sp. P33: SporoP33_14055Help
Entry
SporoP33_14055    CDS       T04790                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
spor  Sporosarcina sp. P33
Brite
KEGG Orthology (KO) [BR:spor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spor01001]
    SporoP33_14055
Enzymes [BR:spor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SporoP33_14055
Protein kinases [BR:spor01001]
 Serine/threonine kinases: Other
  Bacterial family
   SporoP33_14055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Pkinase_fungal RIO1 Kdo FTA2 PIP49_C Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: ARD49255
LinkDB All DBs
Position
2900403..2902403
Genome map
AA seq 666 aa AA seqDB search
MIGKRIGKRYEIIRVIGDGGMSRVYLAHDIILDRDVAIKVLHYDFANEEELKKRFQREAL
SATSLTHPHIVNIFDVGQEDELHYLVMEYIPGRTLKDYIHTHGALSAEHAVSIMQQLVSA
ISHAHHNGIVHRDIKPQNVLMNSEDDVKITDFGIAMALNSTVHTKTNSVIGTVHYLSPEQ
ARGGMATKRSDIYSLGIVFYELLTGELPFSAETAVAIALKHLQEETPSVRDQFPEIPQSV
ENIILKATAKDSMCRYETADEMYDDLLTVLSPERANESKFTLPFDDDKTMAIPVIRDVPK
FEDAEDTMKIPPAKEDPVSPVKKKKRKWPYVAAGGILLAALLAFLLFMMMKPKEIIVPKV
VGEEELAATEILEKEGFVIDERFEETSDEFDAGKVTKTVPEAGKKRKEGDGVKLFISTGK
DTMKLSDYTGRNFEATKRFLEGYGFKLIEPVEVYSEEPKGTIISQQPEADQPVIPEDTKL
IFTVSKGKELHSLNDLSGMSAKQLEDYAKRSGLKIHIVSEEYSDTVTKGHVVSQKPAKGE
KLEKGERVDVVVSKGPASKPVKLLVKTIHIPYKYPENQPEDEFDGEDEGNPDSDSDPETE
LTPQKIQIFIQDRTHTMNDPVEEFEITEDTTRKITIEIEEGARGGYKIMRDQTVIEQNKF
DYKELE
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgattggtaaacgaatcggtaaacgatatgaaattattcgggtcatcggagacgggggc
atgtccagagtctatttggcgcatgatatcattctcgaccgcgacgtagccattaaagta
ctgcattatgattttgccaatgaagaggagttaaagaagcgatttcagcgggaggcactt
tccgcgaccagtctgacacatcctcatattgtaaatatttttgatgtcggccaagaagat
gaactccattacctggtgatggaatacatacccggcagaacgttgaaagactatatccac
acccatggcgcattgtcggcagaacacgctgtatccattatgcagcagctggtgtcagct
atctcgcatgcgcatcataacggtattgtgcaccgcgatatcaaaccgcaaaatgttctc
atgaatagtgaagatgatgtgaaaatcacggactttggaatagcgatggcgctgaattcc
acggttcacaccaaaacaaattctgtgatcggcacggttcattacctgtcacctgaacag
gcaagagggggcatggcgacaaagcgttcggatatttattcactcggcattgtcttttat
gaattactgacgggtgaattgccgttttcagcggaaacagctgttgccattgcactaaag
caccttcaggaagaaacgccgtctgtccgcgaccagtttcctgaaattccgcagagcgtt
gaaaatatcatcctgaaagcaactgcaaaagattcaatgtgccgctatgaaacagcggat
gaaatgtacgatgatttattgaccgtattatcacctgaacgggcaaatgaaagtaaattt
actttaccttttgatgatgataagacaatggcgatcccggtgattcgtgatgtgccgaag
tttgaagatgcggaagacaccatgaaaattccgccggcgaaagaggaccctgtatctccc
gtgaaaaagaaaaagaggaaatggccttatgtggcggctggcggtatattattggcggcg
ctgctggcatttctgctgttcatgatgatgaagccgaaagagatcatcgtgcctaaagtg
gtaggggaggaagagctcgccgcaacggagatactggaaaaggaaggctttgtcattgat
gagcgatttgaagagacatccgatgagttcgatgccggaaaagttaccaagacggtcccg
gaagcgggcaagaaacgcaaagaaggcgacggtgtcaaactcttcatcagtacgggcaaa
gatacgatgaagctcagcgactataccgggcgaaattttgaagcaacgaaacgtttcctt
gaaggttatggttttaagctgattgagccagtggaagtctactctgaagaacctaaaggc
acaatcatcagccagcagccagaagctgatcagcctgtcattcctgaagatacgaaattg
atttttactgtgagtaaaggcaaagaacttcactctcttaatgacctgtcagggatgtct
gctaaacagctggaggattacgcgaaaagatctggactgaaaattcatattgtcagcgag
gaatactcagacacagtcacaaaggggcatgtcgtctcacaaaaaccggctaaaggtgag
aaattggaaaaaggtgagcgggtggatgtagtagtatccaagggacctgcatcaaaaccg
gtcaaactgctggtcaaaaccattcatataccttacaaatatcccgaaaaccagccagaa
gatgaatttgacggagaggatgaaggaaatcctgattcggattctgacccagagacggaa
ctaacacctcagaaaatccaaatttttatccaagaccggacacataccatgaacgatcca
gtggaggaatttgaaattacggaagatacgacccgtaaaatcactattgaaattgaagaa
ggagcgcgcggaggatataaaatcatgcgcgatcaaacagtgattgaacaaaataagttt
gactataaagagttagagtag

DBGET integrated database retrieval system