KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_01075Help
Entry
SPAB_01075        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00860  Porphyrin and chlorophyll metabolism
spq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPAB_01075
Enzymes [BR:spq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     SPAB_01075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 PrmA Methyltransf_12 GidB Methyltransf_25 Cons_hypoth95 Methyltransf_4 PCMT Methyltransf_11 Met_10 CMAS Methyltransf_2 Methyltransf_23 DOT1 RrnaAD Methyltransf_18 UPF0020 Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: ABX66496
LinkDB All DBs
Position
979472..980050
Genome map
AA seq 192 aa AA seqDB search
MKDELFLRGENVPMTKEAVRALALSKLELHRASHLIDVGAGTGSVSIEAALQFPSLQVTS
IERNPAALRLLDENRQRFACGNIDILPGEAPMTITGKADAVFMGGSGGHLTALIDWAMGH
LHPGGRLVMTFILQENLHSALAHLAHIGACRMDCVQLQLSSLTPLGAGHYFKPNNPVFVI
ACQKEENHVRDI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgagctttttctgcgcggcgagaacgtgccaatgaccaaagaggcggtacgg
gcgctggcactgtcgaaacttgagctccaccgcgccagtcacctgattgacgtcggggcg
ggaacgggaagcgtctcaattgaagcggcgctgcaatttccttcgttgcaggtgacgtct
atcgagcgtaatcctgccgcgctacggctgcttgatgagaatcgtcagcgctttgcctgc
ggcaatatcgatattctccctggcgaagcgccaatgaccataaccgggaaagccgatgcg
gtgtttatgggcggcagcggcgggcatctgacggcgctgattgactgggcgatgggccat
ctgcatcccggtggccgtctggtgatgacctttatcttgcaggaaaaccttcatagcgcg
ctggcgcatcttgcgcacatcggcgcatgtcgaatggactgtgtacagcttcagctttca
tcgttaacgccgctgggggcggggcactatttcaaaccgaacaatcctgtttttgttatc
gcctgtcagaaggaagaaaaccatgtcagagacatttga

DBGET integrated database retrieval system