KEGG   Streptomyces pristinaespiralis: SPRI_3436Help
Entry
SPRI_3436         CDS       T04073                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00250  Alanine, aspartate and glutamate metabolism
spri00410  beta-Alanine metabolism
spri00430  Taurine and hypotaurine metabolism
spri00650  Butanoate metabolism
spri01100  Metabolic pathways
spri01110  Biosynthesis of secondary metabolites
spri01120  Microbial metabolism in diverse environments
spri02024  Quorum sensing
Module
spri_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:spri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SPRI_3436
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPRI_3436
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPRI_3436
   00430 Taurine and hypotaurine metabolism
    SPRI_3436
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SPRI_3436
Enzymes [BR:spri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SPRI_3436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALC21742
UniProt: A0A0M4DJC3
LinkDB All DBs
Position
4000956..4002380
Genome map
AA seq 474 aa AA seqDB search
MALHQGTTGTEDHTPERRRLAVNPFFGPADPVGGRTAAPPTHRLPDGPMPPLTAYQLVHD
ELMLDGNSRLNLATFVTTWMEPQAADLMAECRDKNMIDKDEYPRTAELERRCVAMLADLW
HAPDPASAVGCSTTGSSEACMLAGLALKRRWAKRNGDRYPAKARPNLVMGVNVQVCWEKF
CNFWEVEARLVPMEGNRFHLDPQAAAELCDENTIGVVAVLGSTFDGSYEPVGELCAALDD
LQERTGLDIPVHVDGASGAMVAPFLDEDLVWDFRLPRVCSINTSGHKYGLVYPGVGWALW
RSPDELPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQHTARDV
ATGLAERIGALDDFRLLTRGDQLPVFAFTTAPDVTSFDVFDVSRRLRERGWLVPAYTFPA
NRRDLSVLRVVCRNGFSADLAELLLEDLRLLLPELRAQVRPLTRDAAQATAFHH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcactccatcagggcaccacggggaccgaggaccacacgccggagcggcgccggctg
gcggtcaatcccttcttcggtccggcggacccggtcggcgggcggacggccgccccgccc
acgcaccgtctcccggacggcccgatgccgcctctcacggcgtatcagctggtgcacgac
gagctgatgctcgacgggaactcccgcctcaacctcgccaccttcgtcaccacctggatg
gagccgcaggcggcggacctgatggccgagtgccgggacaagaacatgatcgacaaggac
gagtacccccgcacggccgagctggagcgcaggtgtgtcgcgatgctcgcggacctgtgg
cacgcgccggacccggcctcggccgtcggctgttcgacgaccgggtcgagcgaggcctgc
atgctcgccgggctggccctcaagcggcggtgggcgaagcggaacggcgaccgctatccg
gcgaaggcccggcccaacctggtgatgggcgtcaacgtgcaggtctgctgggagaagttc
tgcaacttctgggaggtcgaggctcggctcgtgcccatggaggggaaccgcttccacctc
gacccgcaggccgccgccgagttgtgcgacgagaacaccatcggggtggtggcggtgctc
ggctcgaccttcgacggctcctacgagccggtcggcgagctctgcgccgcgctggacgac
ctccaggagcgcaccggcctggacatcccggtccatgtcgacggcgcgtcgggcgcgatg
gtcgcgcccttcctcgacgaggacctcgtctgggacttccggctgccgcgggtgtgctcc
atcaacacctccgggcacaagtacggcctggtctaccccggcgtggggtgggcgctgtgg
cgctcgcccgacgaactcccggaggagctggtcttccgggtgaactacctgggcggcgac
atgccgaccttcgccctcaacttctcccgccccggcgcccaggtggtggcgcagtactac
acgttccttcggctggggcgcgagggttaccgggccgtccagcacacggcccgtgatgtg
gcgacggggctcgccgaacggatcggggcgctggacgacttccggctgctcacccggggc
gatcagttgcccgtcttcgcgttcaccaccgcccccgacgtgacgtccttcgacgtcttc
gacgtgtcgcggcggctgcgggagcggggatggctggttcccgcctacaccttcccggcg
aaccgccgggacctctcggtgctgcgggtggtctgccgcaacggcttctcggcggacctc
gcggagctgctcctggaggacctgcggctgctgcttcccgaactgcgcgcgcaggtgcgc
cctttgaccagggatgccgcgcaggccacggccttccaccactga

DBGET integrated database retrieval system