KEGG   Streptomyces pristinaespiralis: SPRI_3436Help
Entry
SPRI_3436         CDS       T04073                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00250  Alanine, aspartate and glutamate metabolism
spri00650  Butanoate metabolism
spri01100  Metabolic pathways
spri01110  Biosynthesis of secondary metabolites
spri01120  Microbial metabolism in diverse environments
spri02024  Quorum sensing
Module
spri_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:spri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SPRI_3436
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPRI_3436
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPRI_3436
   00430 Taurine and hypotaurine metabolism
    SPRI_3436
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SPRI_3436
Enzymes [BR:spri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SPRI_3436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALC21742
UniProt: A0A0M4DJC3
LinkDB All DBs
Position
4000956..4002380
Genome map
AA seq 474 aa AA seqDB search
MALHQGTTGTEDHTPERRRLAVNPFFGPADPVGGRTAAPPTHRLPDGPMPPLTAYQLVHD
ELMLDGNSRLNLATFVTTWMEPQAADLMAECRDKNMIDKDEYPRTAELERRCVAMLADLW
HAPDPASAVGCSTTGSSEACMLAGLALKRRWAKRNGDRYPAKARPNLVMGVNVQVCWEKF
CNFWEVEARLVPMEGNRFHLDPQAAAELCDENTIGVVAVLGSTFDGSYEPVGELCAALDD
LQERTGLDIPVHVDGASGAMVAPFLDEDLVWDFRLPRVCSINTSGHKYGLVYPGVGWALW
RSPDELPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQHTARDV
ATGLAERIGALDDFRLLTRGDQLPVFAFTTAPDVTSFDVFDVSRRLRERGWLVPAYTFPA
NRRDLSVLRVVCRNGFSADLAELLLEDLRLLLPELRAQVRPLTRDAAQATAFHH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcactccatcagggcaccacggggaccgaggaccacacgccggagcggcgccggctg
gcggtcaatcccttcttcggtccggcggacccggtcggcgggcggacggccgccccgccc
acgcaccgtctcccggacggcccgatgccgcctctcacggcgtatcagctggtgcacgac
gagctgatgctcgacgggaactcccgcctcaacctcgccaccttcgtcaccacctggatg
gagccgcaggcggcggacctgatggccgagtgccgggacaagaacatgatcgacaaggac
gagtacccccgcacggccgagctggagcgcaggtgtgtcgcgatgctcgcggacctgtgg
cacgcgccggacccggcctcggccgtcggctgttcgacgaccgggtcgagcgaggcctgc
atgctcgccgggctggccctcaagcggcggtgggcgaagcggaacggcgaccgctatccg
gcgaaggcccggcccaacctggtgatgggcgtcaacgtgcaggtctgctgggagaagttc
tgcaacttctgggaggtcgaggctcggctcgtgcccatggaggggaaccgcttccacctc
gacccgcaggccgccgccgagttgtgcgacgagaacaccatcggggtggtggcggtgctc
ggctcgaccttcgacggctcctacgagccggtcggcgagctctgcgccgcgctggacgac
ctccaggagcgcaccggcctggacatcccggtccatgtcgacggcgcgtcgggcgcgatg
gtcgcgcccttcctcgacgaggacctcgtctgggacttccggctgccgcgggtgtgctcc
atcaacacctccgggcacaagtacggcctggtctaccccggcgtggggtgggcgctgtgg
cgctcgcccgacgaactcccggaggagctggtcttccgggtgaactacctgggcggcgac
atgccgaccttcgccctcaacttctcccgccccggcgcccaggtggtggcgcagtactac
acgttccttcggctggggcgcgagggttaccgggccgtccagcacacggcccgtgatgtg
gcgacggggctcgccgaacggatcggggcgctggacgacttccggctgctcacccggggc
gatcagttgcccgtcttcgcgttcaccaccgcccccgacgtgacgtccttcgacgtcttc
gacgtgtcgcggcggctgcgggagcggggatggctggttcccgcctacaccttcccggcg
aaccgccgggacctctcggtgctgcgggtggtctgccgcaacggcttctcggcggacctc
gcggagctgctcctggaggacctgcggctgctgcttcccgaactgcgcgcgcaggtgcgc
cctttgaccagggatgccgcgcaggccacggccttccaccactga

DBGET integrated database retrieval system