KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs1768Help
Entry
SPs1768           CDS       T00119                                 

Definition
(GenBank) putative NADH oxidase/alkyl hydroperoxidase reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Brite
KEGG Orthology (KO) [BR:sps00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPs1768
Enzymes [BR:sps01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SPs1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 GIDA FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C Glutaredoxin FAD_binding_3 Lycopene_cycl Thioredoxin_4 NAD_binding_8 LPD7 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BAC64863
LinkDB All DBs
Position
1786208..1787740
Genome map
AA seq 510 aa AA seqDB search
MALSPDIKEQLAQYLTLLEADLVLQVSLGDNEQSQKVKDFVEEIAAMSERISIENITLDR
QPSFKVAKKGHDSGVVFAGLPLGHELTSFILALLQVSGRAPKVDQDVIDRIKAIDRPLHF
ETYVSLTCHNCPDVVQALNIMSVLNDKISHTMVEGGMFQDEVKAKGIMSVPTVFLDGEEF
TSGRATIEQLLEQVAGPLSEEAFADKGLYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVMETVGIENMISTLYTEGPKLMAEVEAHTKSYDVDIIKAQLATSIEKKENIEVTLA
NGAVLQAKTAILALGAKWRNINVPGEDEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSGL
EAALDLAGLAKHVYVLEFLPELKADKVLQDRAAKTNNLTIIKNVATKDIVGEDHVTGLSY
TERDSGEDKHLDLEGVFVQIGLVPNTAWLKDSGVNLTDRGEIIVDKHGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtcctgatattaaagaacaacttgcccaatacctcaccctgttagaagct
gatcttgttttgcaagtttcccttggtgacaatgagcagtctcaaaaagtcaaagacttt
gtggaagaaatagctgctatgtctgagcgtatttctattgaaaacatcactttagaccga
caaccaagctttaaggttgcgaaaaaaggtcacgatagtggggttgtctttgccggcctt
cctttaggccacgaattgacgtcctttattcttgctctcttgcaagtatctggacgtgct
ccaaaagtggatcaagatgttattgatcgcatcaaggccattgaccgtccgttgcatttt
gaaacttatgtcagcttaacctgccataactgcccagatgttgttcaagctttaaacatt
atgtccgtcttgaacgacaagatttcacacactatggtagaaggcggcatgttccaagat
gaagtgaaagccaaaggcattatgtctgtccctactgtctttttagacggggaggaattc
acttctggtcgtgctaccattgagcaactcttagaacaagtcgctggcccactttctgag
gaagcctttgctgataaaggcctctatgatgtccttgttattggtggtggccctgcgggc
aatagcgctgctatctatgcagctcgtaaaggactaaaaacaggtttacttgctgaaacc
tttggtggtcaggtcatggaaactgtcggcatcgaaaacatgattagtaccctttacact
gaaggaccaaaattaatggccgaagtggaggcccatactaagtcttatgatgttgatatt
atcaaagcacaactagctacttctattgagaaaaaagaaaacatcgaggttactctagct
aatggtgcggttttacaagccaaaactgctatcttagctcttggggccaaatggcgtaac
attaatgttcctggtgaagatgaattccgtaataaaggggtgacttactgccctcactgt
gacggtcctctctttgaaggcaaagatgttgctgttatcggtggtggtaactccggttta
gaagcggcccttgatttggctggtcttgctaaacacgtttacgttttagaattcttgccc
gagctcaaagctgacaaagtgcttcaagaccgcgcagctaagactaacaatctgaccatc
atcaaaaatgttgctactaaggatattgttggagaggaccatgttacaggtcttagctac
actgagcgtgatagcggtgaagacaaacaccttgaccttgaaggggtctttgttcaaatt
ggtcttgttccaaacacagcttggctcaaagatagtggtgtcaacctaaccgaccgcggt
gaaatcattgtggataaacatgggtcaaccaatattcctggtatctttgctgctggggac
tgtactgattcagcttataaacaaatcattatttccatggggtctggtgctactgctgcc
atcggtgcctttgactacttgattcgtcaataa

DBGET integrated database retrieval system