KEGG   Sulfitobacter pseudonitzschiae: SULPSESMR1_02634Help
Entry
SULPSESMR1_02634  CDS       T04974                                 

Gene name
dddL
Definition
(GenBank) putative dimethlysulfonioproprionate lyase DddL
  KO
K16953  dimethylpropiothetin dethiomethylase [EC:4.4.1.3]
Organism
spse  Sulfitobacter pseudonitzschiae
Pathway
spse00920  Sulfur metabolism
spse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spse00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SULPSESMR1_02634 (dddL)
Enzymes [BR:spse01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.3  dimethylpropiothetin dethiomethylase
     SULPSESMR1_02634 (dddL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMSP_lyase Cupin_7 Cupin_2
Motif
Other DBs
NCBI-ProteinID: ASM73429
UniProt: A0A221K369
LinkDB All DBs
Position
complement(2659526..2660236)
Genome map
AA seq 236 aa AA seqDB search
MTDTTSPADLRLRDCPNWTYLLREFDVLYRNGTAGGSPSIRSHRKRVRDRLSACVASNPA
ILSRPHEVKPVTAHFARALDLGERSAMQGMARALREVRGDLAWEYGYDKLPKALAQKYAY
CEVLGPKGPVQSDGLILGFVLFAPATTYPQHSHQDIEESYISVSGAWSENDTAVYAPGSL
ILNRSGDEHRITTGELDPCLLAYAWTGAAGRLAEPMMKLTATRKAGAITAKSRGPY
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacaacgtcccccgccgatcttcggcttcgggattgcccgaactggacctat
ttgctgcgcgagttcgatgtgctgtaccgcaacggcaccgcagggggcagcccgtcgatc
cgcagtcaccgcaaacgggtgcgcgacaggctgtcggcctgtgtggcatccaaccccgcg
attttgtcccgtccgcacgaggttaagcctgtgaccgcacatttcgcccgtgcgctggat
ctgggtgagcggtcggcgatgcagggcatggcgcgggctttgcgcgaagtgcgcggcgat
ctggcgtgggaatatggctatgacaagctacccaaggcgctggcgcagaaatacgcctat
tgcgaggttttgggcccgaaggggccggtgcagtccgacgggttgattttgggctttgtg
ctgttcgcgcccgccaccacctatccccagcacagccatcaggacatcgaggaaagctat
atctctgtttcgggtgcgtggtctgaaaatgacacggccgtttacgcgccggggtcgttg
attctgaaccgttctggcgacgaacatcggatcaccacaggagagctggacccctgtctt
ctggcctatgcgtggacaggtgcagcagggcggttggccgagccgatgatgaagcttacg
gccacgcgcaaggcaggggcgatcacggccaaatcacgtgggccatactga

DBGET integrated database retrieval system