KEGG   Shewanella psychrophila: Sps_00622Help
Entry
Sps_00622         CDS       T05063                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spsw  Shewanella psychrophila
Brite
Enzymes [BR:spsw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sps_00622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AQS35816
UniProt: A0A1S6HJW5
LinkDB All DBs
Position
complement(666073..666654)
Genome map
AA seq 193 aa AA seqDB search
MAFELPALPYAKDALEPHISKETIEFHYGKHHNTYVVKLNGLVDGTELAEKSLEEIIKTS
TGGIFNNAAQIWNHTFYWNCLSPNGGGAATGAVAKAIDEAFGSFEAFKAKFTDSAVNNFG
SAWTWLVKNADGSVAIVNTSNAATPLTDSSVTPIMTVDVWEHAYYIDYRNVRPDYMAHFW
ELVNWDFVNKNFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaactaccagcattaccttatgctaaagacgcactagaaccacatatctcc
aaagagacgattgaatttcattatggtaagcatcacaacacctacgtcgttaagctaaat
ggcctagttgatggtactgaacttgctgaaaaaagccttgaagagatcatcaagacctca
actggcggtatcttcaacaatgctgcacagatttggaaccacactttctactggaactgt
ttatcaccaaatggcggcggcgcagcaacgggggcagtagctaaggctatcgatgaggca
tttggttctttcgaagcgttcaaggctaaattcaccgattcagcagtaaacaactttggt
agcgcttggacttggctagttaaaaatgctgacggtagcgtcgctattgttaatactagc
aatgctgcaacaccactgactgatagcagtgttacgcccattatgacggttgatgtttgg
gaacatgcttactacattgattatcgtaatgtacgtcctgattacatggctcatttctgg
gaattggttaactgggatttcgttaacaaaaatttcgcgtaa

DBGET integrated database retrieval system