KEGG   Shewanella psychrophila: Sps_01253Help
Entry
Sps_01253         CDS       T05063                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spsw  Shewanella psychrophila
Pathway
spsw00473  D-Alanine metabolism
spsw00550  Peptidoglycan biosynthesis
spsw01100  Metabolic pathways
spsw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sps_01253
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sps_01253
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Sps_01253
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spsw01011]
    Sps_01253
Enzymes [BR:spsw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sps_01253
Peptidoglycan biosynthesis and degradation proteins [BR:spsw01011]
 Precursor biosynthesis
  Amino acid ligase
   Sps_01253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK Glyco_hydro_36
Motif
Other DBs
NCBI-ProteinID: AQS36422
UniProt: A0A1S6HLP0
LinkDB All DBs
Position
1376372..1377382
Genome map
AA seq 336 aa AA seqDB search
MSQTNLLLLCGGGGDEHAISLMSAKFFETSLAKLAHINLLKVELDAQGHYRTSDGELCEL
TNRKQIRFDDVSKVSWPVDYVIPCIHGYPGETGDIQSYFELINLPYFGCDSEASRNCFNK
VTAKMWFTALGIPNTPYIFLNDFNDDAINQAKRALTSWGSIFIKAASQGSSVGCYRVDSK
EELTESLKQAFNYSPYVIVEKTIEARELEVAVYEKNGEIIATQPGEIICGTNTFYTFDEK
YAENSQAETKVVADISESVSQEIREYAVKVFKGMKLSHLSRIDFFLTQDNEILLNEINTF
PGLTPISMFPKMLQNHGDDFSDYLNRNIMDQLSKNV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacgaatctactattattatgtggtggcggtggggatgaacatgcaatctca
ttgatgtcagcgaaattttttgagacctcattggccaaacttgcccatataaacctattg
aaagtcgaacttgatgcacagggccattatcgaactagcgacggtgaactctgtgaactg
accaatcgcaaacaaatacgtttcgatgacgtgagtaaagtatcctggcctgtggattac
gtcattccctgcattcacggttaccctggagaaacaggtgatattcaatcctattttgag
ctgatcaacttgccctattttggttgcgattcagaagcgagtcgtaattgtttcaacaaa
gtcacggctaagatgtggttcacggcacttgggatccccaataccccttatattttcctc
aatgactttaatgatgacgctatcaatcaagccaagcgggctttaacatcttggggctcg
atattcatcaaggccgcgtcacaaggctcatctgttggttgttaccgtgtagacagcaaa
gaggaattaactgagtcattgaagcaagctttcaactattcgccttatgtcatcgtcgaa
aagaccattgaagccagagagcttgaagtggccgtatacgagaaaaacggcgaaattatc
gcgactcagccaggtgagatcatctgtgggacaaataccttctacactttcgatgaaaag
tacgccgagaacagtcaggccgaaaccaaagtggttgccgatatcagtgagagtgtgagc
caggagatccgtgaatatgcagtcaaggtattcaaaggcatgaaactcagtcacttgtcc
cgtatcgactttttcctcacccaagacaacgaaattcttctcaatgaaattaatactttc
ccagggctcacccctatctccatgttccccaagatgttacagaatcatggcgatgatttc
agcgattacctcaaccgcaacatcatggaccaactgagtaagaacgtctga

DBGET integrated database retrieval system