KEGG   Streptomyces puniciscabiei: BFF78_17140Help
Entry
BFF78_17140       CDS       T05140                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
spun  Streptomyces puniciscabiei
Pathway
spun00564  Glycerophospholipid metabolism
spun01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spun00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BFF78_17140
Enzymes [BR:spun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BFF78_17140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AOR37136
UniProt: A0A1D7YNK0
LinkDB All DBs
Position
complement(4157867..4159576)
Genome map
AA seq 569 aa AA seqDB search
MRTATLGPAQRAEALAAMAERELDLLVIGGGVVGAGTTLDAVTRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSMARGHGRGLPLHRHLTHRQALRVAPCLKKDALVGALQYYDAQMDDARF
VATLVRTAASYGAKAANRARVTGFLREGERVVGARVQDVEGGGEYEIRAKQIVNATGVWT
DDTQGMVGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLAVPLGRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPAPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDMRVADCVTEEIPLLGAEGYQAL
WNARARIAARTGLHVARVEHLLNRYGAMAEELLDLVAADPALGAPLQAADDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSAREAAELMAPVLGWDKGQIEREVEHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPLS
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgactctgggtccggcgcagcgcgccgaggcactggcggcgatggcggag
cgcgagctggacctgctggtgatcggcggcggagtcgtcggcgcgggcaccacgctggac
gcggtcacccgcggcctgtccaccggcctggtcgaggcccgcgactgggcgtccggcact
tccagccggtccagcaagctgatccacggcggcctgcgctatctggagatgctcgacttc
gccctcgtacgggaagcgctgaaggagcgcgggctgctcctggagcggctcgccccccac
ctcgtcaaaccggtgccgttcctgtacccgttgcagcacaagggctgggagcggctgtac
gcgggctcgggcgtggccttgtacgacgcgatgtccatggcgcgcgggcatggccggggg
ctgcccctgcaccggcacctgacccaccgtcaggccctgcgcgtggccccctgcctgaag
aaggacgccctggtcggcgccctgcagtactacgacgcccagatggacgacgcccgcttc
gtggccacgctggtgcgcacggcggcgtcctacggcgcgaaggcggccaaccgcgcgcgc
gtgaccgggttcctgcgcgagggcgagcgggtggtcggcgcccgcgtgcaggacgtggag
ggcggcggggagtacgagatccgcgccaaacagatcgtcaacgcgaccggcgtgtggacc
gacgacacgcagggcatggtgggggagcgcggccagttccacgtccgcgcctccaagggc
atccacctggtcgtgcccaaggaccgcatccactccagcaccggcctgatcctgcgtacc
gagaagtccgtcctgttcgtcatcccctggggccggcactggatcatcggcaccaccgac
accgactgggacctcgacaaggcccacccggccgcctccagcgccgacatcgactatctg
ctggagcacgtcaactcggtgctcgcggtgccgctcggccgcgacgacgtacagggggtg
tacgccggtctgcgcccgctgctcgccggcgagtccgacgccaccagcaagctgtcccgc
gagcacacggtcgcccatccggcgccgggactcgtggtcgtggcgggcggcaagtacacc
acctaccgggtgatggcgaaggacgcggtcgacgaggcggtgcacggcctggacatgcgc
gtcgccgactgtgtgacggaggagatcccgctgctgggcgcggagggctaccaggcgctg
tggaacgcgcgcgcccggatcgccgcccgcaccggactgcacgtggcccgcgtggagcac
ctgctgaaccggtacggcgccatggccgaggagctcctggacctcgtcgccgccgacccc
gccctgggcgcgccgctgcaggccgccgacgactatctgcgcgccgaagtggtgtacgcc
gcctcgcacgagggcgcgcggcacctggacgacgtcctcacccgccgcacccgcatctcc
atcgaaaccttcgaccggggcacccgcagcgcccgtgaggcggccgagctgatggcaccg
gtcctcggctgggacaagggccagatcgagcgcgaggtggagcactacgagaagcgggtg
gaggccgagcgggagtcgcagcgccagccggacgacctgacggcggacgcggcgaggctg
ggggcgccggacatcgtgccgctcagctga

DBGET integrated database retrieval system