KEGG   Streptomyces puniciscabiei: BFF78_19190Help
Entry
BFF78_19190       CDS       T05140                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
spun  Streptomyces puniciscabiei
Pathway
spun00250  Alanine, aspartate and glutamate metabolism
spun00410  beta-Alanine metabolism
spun00430  Taurine and hypotaurine metabolism
spun00650  Butanoate metabolism
spun01100  Metabolic pathways
spun01110  Biosynthesis of secondary metabolites
spun01120  Microbial metabolism in diverse environments
spun02024  Quorum sensing
Module
spun_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:spun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BFF78_19190
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BFF78_19190
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BFF78_19190
   00430 Taurine and hypotaurine metabolism
    BFF78_19190
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BFF78_19190
Enzymes [BR:spun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BFF78_19190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AOR32906
UniProt: A0A1D7YBP3
LinkDB All DBs
Position
4562901..4564307
Genome map
AA seq 468 aa AA seqDB search
MALHKGPEKRQERTMSVNPFYGEANPVGGMTEAPPTHRLPDAPLAPSTAYQLVHDELMLD
GNSRLNLATFVTTWMEPQAGVLMAECRDKNMIDKDEYPRTAELERRCVAMLADLWNAPDP
SAAVGCSTTGSSEACMLAGMALKRRWAGRNADRYPGARPNLVMGVNVQVCWEKFCNFWEV
ETRLVPMEGDRFHLDPQAAVELCDENTIGVVGILGSTFDGSYEPVADLCAALDALQERTG
LDIPVHVDGASGGMVAPFLDPDLVWDFRLPRVASINTSGHKYGLVYPGVGWALWRDEEAL
PEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQQSTRDVATSLAG
RIEALGDFRLLTRGDELPVFAFTTAPDVTSYDVFDVSRRLRESGWLVPAYTFPANRQDLS
VLRVVCRNGFSHDLADLFLDDLARLVPELRRQPHPLTRDKGAATGFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcacaaaggtcccgagaaacgccaagagcggacgatgtcggtcaacccgttc
tacggagaggccaatccggtcggcggcatgaccgaggccccgcccacgcaccggctcccg
gacgcgccgctggccccgtcgacggcgtaccagctggtgcacgacgagctgatgctggac
ggcaactcccggctgaatctggccacgttcgtgaccacctggatggagccgcaggccggg
gtgctgatggcggagtgccgggacaagaacatgatcgacaaggacgagtacccgcgcacg
gccgagctggagcggcgctgtgtggcgatgctcgccgacctgtggaacgcgcccgatccg
tcggcggcggtgggctgttcgacgaccgggtcgagcgaggcgtgcatgctcgccgggatg
gcactgaaacgacggtgggccggccggaacgccgaccgctatccgggggcgcggcccaac
ctggtcatgggcgtcaacgtccaggtgtgctgggagaagttctgcaacttctgggaggtg
gagacccggctggtgcccatggagggcgaccggttccacctggacccgcaggccgccgtg
gagctgtgcgacgagaacaccatcggggtcgtcggcatcctcggctcgaccttcgacggc
tcctacgagccggtcgccgacctgtgcgccgccctggacgccctccaggagcgcacgggg
ctcgacatcccggtgcacgtggacggcgcgtccggcggcatggtggcgcccttcctggac
ccggacctggtgtgggacttccggctgccgcgcgtggcctcgatcaacacctccgggcac
aagtacggactggtgtatccgggcgtcggctgggcgctgtggcgggacgaggaggctctg
cccgaggaactggtcttccgggtcaactacctgggcggcgacatgccgaccttcgccctc
aacttctcccgtcccggcgcccaggtggtcgcgcagtactacaccttcctgcggctcggc
cgcgagggctaccgcgcggtgcagcagtccacgcgggacgtggcgacctcgctggccggg
cggatcgaggcgctcggcgacttccggctgctgacccggggcgacgagctgccggtcttc
gccttcaccaccgccccggacgtgacgtcgtacgacgtcttcgacgtctcgcggcggctg
cgcgagagcggctggctggtgcccgcgtacaccttcccggcgaaccggcaggacctgtcc
gtgctccgggtggtgtgccgcaacggcttctcccacgacctggccgacctgttcctggac
gacctggcccgcctggtgccggagctgcgccggcagccgcatcccctgacccgggacaag
ggggcggccaccggcttccatcactag

DBGET integrated database retrieval system