KEGG   Serratia sp. AS13: SerAS13_2163
Entry
SerAS13_2163      CDS       T02012                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sra  Serratia sp. AS13
Pathway
sra00480  Glutathione metabolism
sra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SerAS13_2163
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sra02000]
    SerAS13_2163
Enzymes [BR:sra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SerAS13_2163
Transporters [BR:sra02000]
 Other transporters
  Pores ion channels [TC:1]
   SerAS13_2163
SSDB
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_C_2 GST_N_2 Glutaredoxin2_C GST_C_6 GST_N_5
Other DBs
NCBI-ProteinID: AEG27946
LinkDB
Position
complement(2321492..2322097)
AA seq 201 aa
MKLFYKAGACSLSPHIVLREAGLDFTAEKVDLAQKKTESGADYLAITPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRNLIPAAGTLSRYHAIEWLNYIATELHKGFSPLFNPKTPDE
YKSIARAKLEQQFSYLDSVLAKQHFLLGNRFSVADAYLFTVLRWAVSQQFDLKKYPQLAA
YFDRVAARPAVDAALNAEGLK
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaactgttctataaagccggtgcctgttctctgtccccacatattgtgttgcgtgag
gcgggtctggattttacggcggagaaggtcgatctggcgcagaaaaagaccgaaagcggc
gcagactacctggcgatcacccccaaaggacaggtaccggcactgctgctcgatgatggc
agcctgctgaccgagggcgtggcgattgtgcaatatttagcggatcgcgtgcctgatcgc
aacctgatcccggcggcgggaacgctgtcgcgctatcatgccattgagtggttgaactat
attgcgaccgaattgcacaagggatttagcccgctgttcaatccaaaaacgccggatgaa
tacaagagcatcgcacgcgccaaactggagcaacagttcagctatttggactctgtgctg
gcgaaacagcatttcctgttgggaaaccgattcagcgtggcagatgcctatctgtttacc
gttttgcgttgggccgtctcccagcagttcgatctcaaaaaatacccccagttagcggcg
tattttgacagagtagctgcgcggccagcggtggatgcggcgttgaacgccgaaggtttg
aaataa

DBGET integrated database retrieval system