KEGG   Streptomyces rapamycinicus: M271_05065Help
Entry
M271_05065        CDS       T02907                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
src  Streptomyces rapamycinicus
Pathway
src00250  Alanine, aspartate and glutamate metabolism
src00410  beta-Alanine metabolism
src00640  Propanoate metabolism
src00650  Butanoate metabolism
src01100  Metabolic pathways
src01120  Microbial metabolism in diverse environments
Module
src_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    M271_05065
   00650 Butanoate metabolism
    M271_05065
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M271_05065
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M271_05065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:src01007]
    M271_05065
Enzymes [BR:src01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     M271_05065
Amino acid related enzymes [BR:src01007]
 Aminotransferase (transaminase)
  Class III
   M271_05065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGP52640
UniProt: A0A0A0NDX0
LinkDB All DBs
Position
complement(1281231..1282490)
Genome map
AA seq 419 aa AA seqDB search
MTNLSPQLRQATPVVAVRGEGAYVDGEDGRRYLDFTAGIGVTSTGHCHPRVVAAAQEQVG
TLIHGQYTTVMHPPLRRLVEKLGEVLPTGLDSLFFSNSGSEAVESALRLARQATGRPNVL
VCHGGFHGRTVAAASMTTSGTRFRSGFSPLMSGVVVTPFPTAYRYGWDEETATRFALREL
DYVLQTISPPDDTAAIIVEPVLGEGGYVPATEGFLQGLRERADRHGFLLILDEVQTGVGR
TGRFWGHDHFGIRPDILVTAKGLASGFPLSGIAASEELMSKAWPGSQGGTYGANAVACAA
AAATLDVVREENLVANAEAMGARLRSGLEDVAAKTPAIGDVRGLGLMLASEFVTADGEPD
PATAARVQRAAVDEGLLLLLCGAWNHVVRMIPALVVDEAAIDEGLRAWSAAVQAGTADS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatctgtcgccgcagctccgtcaagccactccggtggtcgccgtccggggagag
ggcgcctacgtcgacggcgaggacgggcggcgatacctcgacttcaccgcgggcatcggc
gtcaccagcaccgggcactgccatccgcgggtcgtcgccgccgcccaggagcaggtgggc
accctcatccacggccagtacacgaccgtgatgcacccgccgctgcggcggctggtcgag
aagctgggcgaggtgctccccacgggcctcgacagtctgttcttcagcaactccggcagc
gaggccgtggagtcggccctgcgcctggcccgccaggccaccggccggcccaacgtcctg
gtctgccacggcggattccacggccgcactgtggccgccgcctccatgaccacctccgga
acccgcttccggtccggtttctcgccgctgatgagcggtgtcgtggtgaccccgttcccc
acggcctaccggtacggctgggacgaggagaccgcgacccggttcgccctgcgggagctg
gactacgtcctgcagaccatctccccgcccgacgacaccgccgcgatcatcgtcgaaccg
gtgctcggcgagggcggctacgtgcccgcgaccgagggcttcctgcagggcctgcgggag
cgggccgaccgccatggcttcctgctgatcctggacgaggtgcagaccggggtgggccgc
accggacggttctggggccatgaccacttcggcatccgtcccgacatcctggtcaccgcc
aaggggctggccagcggcttcccgctgtccggcatcgcggcctccgaggagctgatgagc
aaggcctggcccggctcccagggcggcacctacggcgccaacgccgtggcctgcgcggcc
gccgccgccaccctcgacgtggtccgcgaggagaacctcgtggccaacgccgaggccatg
ggggcgcggctgcgcagcggtctggaggacgtggccgccaagacccccgccatcggcgac
gtgcgcggcctcggcctcatgctggccagcgagttcgtcaccgccgacggcgagccggac
ccggcgaccgcggcccgggtgcagcgcgccgccgtggacgaagggctgttgctgctcctg
tgcggcgcctggaaccatgtggtccggatgatccccgccctcgtcgtcgacgaagcggcg
atcgacgagggtctgcgcgcctggtccgccgccgtccaagccggaacagcggactcctga

DBGET integrated database retrieval system