KEGG   Streptomyces rapamycinicus: M271_13330
Entry
M271_13330        CDS       T02907                                 

Definition
(GenBank) DNA-3-methyladenine glycosylase
  KO
K13529  AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
src  Streptomyces rapamycinicus
Pathway
src03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:src00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    M271_13330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:src03000]
    M271_13330
   03400 DNA repair and recombination proteins [BR:src03400]
    M271_13330
Enzymes [BR:src01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     M271_13330
Transcription factors [BR:src03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    M271_13330
DNA repair and recombination proteins [BR:src03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     M271_13330
SSDB
Motif
Pfam: AlkA_N Ada_Zn_binding HTH_18 HTH_AraC HhH-GPD
Other DBs
NCBI-ProteinID: AGP54260
LinkDB
Position
complement(3454628..3456103)
AA seq 491 aa
MHTDTDRCLRAAQAKDARFDGWFFIAVVTTGIYCRPSCPVVGPKPENMRFYPSAAAAQQA
GFRACKRCRPDASPGSPQWNERADLVARAMRLIADGVVDRDGVPGLAARLGYSTRQIERQ
LLAELGAGPLALARAQRAQTARLLIETSALPMADIAFAAGFASVRAFNETVREIFALSPT
ELRQRAGRGPRTSVPGVLTLRLPFRAPLCPDNLFGHLAATAVPGVEEWRDGAYRRTLRLP
YGPGVVTLSPRPDHIACQLSLADLRDLAGAISRCRRLLDLDADPAAVDDLLRTDLQLAPL
VDKAPGRRVPRAVDADEFAVRAVLGQQVSTAAARTHAGRLVTAHGEPVEDPAGGLTHLFP
SVQALAGLDPEQLAMPRTRRATLTGLIGALAEGRVALGVGSDWDEARASLGALPGLGPWT
VEVIAMRALGDPDAFLPTDLGVRRAATELGLPATPGALTRHSTHWRPWRAYAVQYLWATD
AAHAINRLPAA
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgcacaccgacaccgaccggtgcctccgcgccgcacaggcgaaggacgcccgcttcgac
gggtggttcttcatcgccgtcgtgaccaccgggatctactgccggccgagctgcccggtc
gtcgggcccaagcccgagaacatgcggttctaccccagcgccgcggccgcccagcaggcc
gggttccgggcctgcaagcggtgccgcccggacgccagccccggctcgccgcagtggaac
gagcgggcggatctggtggcccgcgccatgcggctgatcgccgacggcgtggtggaccgg
gacggggtgcccggtctcgccgcccggctgggatacagcacccggcagatcgagcggcag
ctgctcgccgagctcggcgcgggcccgctcgcgctcgccagggcccagcgggcgcagacc
gcgcggctgctgatcgagacgagcgccctgccgatggcggacatcgccttcgcggccggg
ttcgccagtgtccgcgcgttcaacgagaccgtacgcgagatcttcgcgctctccccgacc
gagctgcggcagcgggccggccgggggccgcggaccagcgtgccgggcgtgctcacgctg
cggctgccgttccgggcgccgctgtgccccgacaacctcttcggccacctcgccgccacc
gccgtccccggcgtcgaggagtggcgcgacggcgcgtaccggcgcaccctgcggctgccg
tacgggcccggggtggtcaccctcagcccccggccggaccacatcgcctgccagctctcc
ctcgccgacctgcgcgacctggccggtgcgatcagccgctgccggcggctgctggacctc
gacgcggaccccgccgccgtggacgacctgctccgtacggacctccagctggccccgctg
gtcgacaaggccccggggcggcgggtgccgcgcgcggtggacgcggacgagttcgcggtg
cgcgcggtgctcggccagcaggtgtccacggcggccgcccgcacccacgccgggcgcctg
gtcacggcgcacggcgagcccgtggaggacccggcgggcggcctgacccacctcttcccg
tccgtccaggccctcgccgggctcgaccccgagcagctggccatgccccgcacccgccgc
gccaccctcaccgggctgatcggcgcgctcgccgagggccgggtcgcgctcggcgtcggc
agcgactgggacgaggcccgcgcgagcctcggcgcgctgccggggctcggcccctggacc
gtcgaggtgatcgcgatgcgcgccctcggcgacccggacgccttcctccccaccgacctc
ggagtgcgccgcgccgccaccgaactgggcctgcctgccacgcccggcgccctcacccgc
cactcgacccactggcgcccctggcgcgcctacgccgtccagtacctatgggccacggac
gcggcccacgccatcaaccgcctaccagcggcataa

DBGET integrated database retrieval system