KEGG   Streptomyces rapamycinicus: M271_21000Help
Entry
M271_21000        CDS       T02907                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
src  Streptomyces rapamycinicus
Pathway
src00564  Glycerophospholipid metabolism
src01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    M271_21000
Enzymes [BR:src01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     M271_21000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGP55744
LinkDB All DBs
Position
complement(5265405..5267111)
Genome map
AA seq 568 aa AA seqDB search
MKTPALGPAERGEALARMADRELDVLVVGGGVVGAGTALDAATRGLETGLVESRDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERIAPHLVKPVPFLYPLKHRVWERFY
AGSGVALYDTMSISSGHGRGLPAHRHLSRGRALRVAPCLKKDALVGALQYYDAQMDDARY
VTTLVRTAAEYGAHVANRARVVGFLREGERVVGARVHDLEQGGEFEVRARQVVNATGVWT
DETQALIGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNEVLAVPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDRRVGPCVTEEIPLVGAVGYNAL
WNARERIGRQHGLHAARIEHLLNRYGSAAQEVLDLIAGDASLGKPLAGAEDYLRAEVSYA
ASHEGARHLDDVLTRRTRISIETFDRGTRCAREVAELLGPVLGWAEDQLDREVQHYEKRV
EAERESQRQPDDLTADAARLGAPDIIPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacaccggcactgggaccggccgagcgcggcgaggcgctggcccggatggcggac
cgtgagctcgatgtgctggtcgtgggcggcggcgtggtcggcgcgggcaccgcgctggac
gccgcgacccggggcctggagaccggtctggtcgagtcgcgggactgggcctccggcacc
tccagccggtccagcaagctgatccacggcggactgcgctatctggagatgctggacttc
gcactggtgcgcgaggcgctgaaggagcgcgggctgctgctggagcggatcgcaccgcac
ctggtcaagccggtgccgttcctgtacccgctgaaacaccgggtctgggagcggttctac
gcgggctcgggcgtcgccctctacgacaccatgtcgatctcctcggggcacggccgcgga
ctgcccgcccaccgccatctgagccgcggccgggcgctgcgcgtcgccccctgcctcaag
aaggacgcgctggtcggggcgttgcagtactacgacgcccagatggacgacgcccgctac
gtcaccacgctggtgcgcacggcggcggagtacggcgcccatgtggccaaccgcgcgcgg
gtggtcggcttcctgcgggagggcgagcgcgtggtcggcgcccgggtgcacgacctggag
cagggcggcgagttcgaggtccgcgcccggcaggtggtcaacgccaccggggtgtggacc
gacgagacccaggcgctgatcggcgagcgcggccagttccacgtccgggcctccaagggc
atccacctggtggtccccaaggaccgcatccactccacgaccgggctgatcctgcgcacc
gagaagagcgtgctgttcgtgatcccctggggcaggcactggatcatcggcaccacggac
accgactgggacctggacaaggcccatccggccgcctccagcgccgatatcgactatctg
ctggagcatgtcaacgaggtcctcgcggtgccgctgacccgtgacgacgtggagggcgtc
tacgccgggctgcgcccgctgctggccggggagtcggacgccaccagcaagctctcccgc
gagcacaccgtcgcccatccggtgccgggcctggtggtggtcgcgggcggcaagtacacc
acgtaccgggtgatggccaaggacgccgtggacgaggcggtgcacggcctcgaccgccgg
gtcgggccctgtgtcaccgaggagatcccgctggtcggcgccgtcggctacaacgcgttg
tggaacgcccgggagcggatcggccggcagcacgggctgcacgcggcgcggatcgagcat
ctgctcaaccgctacggctcggcggcgcaggaggtgctggacctgatcgcgggcgacgcc
tcgctggggaagccgctggccggggcggaggactatctgcgtgccgaggtctcttacgcc
gcctcgcacgagggggcccgccatctggacgacgtcctcacccgccgcacccgcatctcg
atcgagaccttcgaccgcggtacgcgctgcgcccgcgaggtggccgagctgctggggccg
gtgctgggctgggccgaggaccagctcgaccgggaggtccagcactacgagaagcgggtg
gaggcggagcgcgagtcgcagcgtcagccggacgatctgacggcggacgcggcccggctg
ggcgcgccggacatcatcccgctgtag

DBGET integrated database retrieval system