KEGG   Streptomyces rubrolavendulae: A4G23_03447Help
Entry
A4G23_03447       CDS       T04616                                 

Gene name
glpD_2
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00564  Glycerophospholipid metabolism
srn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A4G23_03447 (glpD_2)
Enzymes [BR:srn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A4G23_03447 (glpD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AOT60572
UniProt: A0A1D8G537
LinkDB All DBs
Position
3969856..3971562
Genome map
AA seq 568 aa AA seqDB search
MRTARLGPAERAAALAAMAERELDVLVVGGGVVGAGTALDAVTRGLATGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVRPVPFLYPLRHRGWERLY
AGSGVALYDAMSVSSGRGRGLPLHRHLSRRRALRAAPALRRDALVGALQYYDAQVDDARH
VATLVRTAAAYGAHTANRARVVAFLREGERVVGARVADVEAGGEYEIRARQVVNATGVWT
DDTQALIAERGQFHVRASKGIHLVVPKDRVHSTTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLERVNGVLATPLSRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDTRVAPCVTEEVPLLGAEGYRAL
WNARARIAARTGLHVVRVEHLLHRYGTLVDELLDLIADDPSLGEPVAGADDYLRAEILYA
ASHEGARHLDDVLTRRTRISIETFDRGTGCARECAELMARVLGWGEDQVAKEVEHYEKRV
EAERESQRQPDDQTADAARLGAPDIVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgagactgggacccgcggagcgggccgcggccctggcggccatggccgag
cgcgagctggacgtgctggtcgtgggcggtggcgtggtcggggccgggacggcgctcgac
gcggtgacccgtggcctcgccacgggcctggtggaggcccgcgactgggcgtccgggacg
tccagccgctccagcaagctcatccacggcggcctgcgctacctggagatgctcgacttc
gcgctggtgcgggaggccctcaaggagcgcggcctgctgctggagcggctggcgccgcac
ctggtcagaccggtgccgttcctctacccgctgcggcaccggggctgggagcggctgtac
gccggatcgggcgtcgccctgtacgacgcgatgtccgtctcctccggccgcggccggggc
ctgcccctgcaccgccacctgtcgcgccgccgcgccctgcgggccgcccccgccctgcgc
cgggacgccctggtgggcgccctgcagtactacgacgcccaggtggacgacgcccgccac
gtcgccacactggtgcgcacggccgcggcgtacggcgcgcacacggcgaaccgggcccgc
gtcgtcgccttcctccgcgagggcgagcgggtcgtgggcgcccgcgtggcggacgtggag
gccggcggcgagtacgagatccgcgcccgccaggtcgtcaacgcgacgggcgtgtggacc
gacgacacgcaggcgctcatcgcggagcgcggccagttccacgtccgcgcctcgaagggc
atccacctggtcgtccccaaggaccgcgtccactccacgaccggcctgatcctgcgcacc
gagaagagcgtcctgttcgtcatcccctgggggcgccactggatcatcgggacgaccgac
accgactgggacctcgacaaggcccaccccgccgcgtccagcgccgacatcgactacctc
ctggagcgggtcaacggcgtcctggccaccccgctctcccgcgacgacgtgcagggcgtc
tacgcgggcctgcggcccctgctggccggggagtccgacgccaccagcaagctctcccgc
gagcacacggtcgcccaccccgtgcccggcctcgtcgtcgtcgcgggcggcaagtacacg
acgtaccgggtcatggcgaaggacgcggtggacgaggcggtgcacggcctggacacgcgc
gtcgcgccgtgcgtcacggaggaggtgccgctgctgggcgccgaggggtaccgggcgctg
tggaacgccagggcgcggatcgccgcccggacgggcctgcacgtcgtgcgcgtcgagcac
ctgctccaccggtacggcaccctggtggacgagctgctcgacctgatcgccgacgacccc
tcgctgggagagcccgtcgcgggcgccgacgactacctgcgcgccgagatcctctacgca
gcctcccacgagggcgcccggcacctggacgacgtcctgacccgccggacccgcatctcc
atcgagaccttcgaccggggcaccggctgcgcccgcgagtgcgccgaactgatggcgcgg
gtcctcggctggggggaggaccaggtcgccaaggaggtggagcactacgagaagcgggtc
gaggcggagcgggagtcccagcggcagccggacgaccagacggccgacgccgcccggctc
ggcgccccggacatcgtccccctgtag

DBGET integrated database retrieval system