KEGG   Serratia plymuthica AS9: SerAS9_4414Help
Entry
SerAS9_4414       CDS       T01503                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00250  Alanine, aspartate and glutamate metabolism
srr00410  beta-Alanine metabolism
srr00640  Propanoate metabolism
srr00650  Butanoate metabolism
srr01100  Metabolic pathways
srr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SerAS9_4414
   00650 Butanoate metabolism
    SerAS9_4414
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SerAS9_4414
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SerAS9_4414
Enzymes [BR:srr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SerAS9_4414
Amino acid related enzymes [BR:srr01007]
 Aminotransferase (transaminase)
  Class III
   SerAS9_4414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEF47508
LinkDB All DBs
Position
complement(4767221..4768486)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGIGVMCGFYAERAENATLWDVEGNEVIDFASGIAVLNTGHRHPK
VIAAIEQQLKAFTHTAYQIVPYESYVSLAERINQRAPIEGPCKTALFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNIAPADFMQALRELCDQHGILLIADEV
QTGFARTGKLFAMEHYAVKPDLITMAKSLAGGMPLSAVAGRADVMDAPAPGGLGGTYAGN
PLAVAAALAVLDVIDEEQLCQRSQRLGQHLVEVLQQARKTSPAIADIRAQGSMVAVEFKD
PATGKPSAEITRQVQQKALEEGLLLLSCGVNGNVIRFLYPLTIPEEQFTQALGILSRALA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaatcaacgtcgtcaggatgccaccccacgggggattggcgtg
atgtgcggtttttacgccgagcgtgcggagaatgccacgctgtgggacgtagaaggcaat
gaggtgatcgatttcgcttccggtattgctgttctgaataccggacaccggcatccgaag
gtgatcgccgccattgaacagcaactgaaggccttcacccacaccgcttaccaaatcgtt
ccttacgaaagctatgtctcgttggcagagcgcatcaaccagcgcgcaccgatcgaaggc
ccctgtaaaaccgcgttgttcaccaccggcgccgaagcggtggaaaacgcggtcaaaatc
gcccgcgcctataccggccgaccgggcctgatcacctttggcggcggtttccatggccgc
acttacatgaccatggcgctgaccggcaaagtggctccgtacaagctgggcttcgggccc
ttccccggttcggtgttccacggccagtatccgaatgcgctgtatggcgtgaccaccgaa
gacgcgatgaacagcctggagcgcatctttaaggcggatatcgatcccaaacaagtggcc
gccattgtgctggaaccggtgcagggcgagggcggtttcaacattgcgccggccgatttt
atgcaggcgctgcgcgaactgtgcgaccagcacggcattttgctgattgccgacgaagtg
cagaccggttttgcccgtaccggcaagctgtttgccatggaacattacgcggtgaaaccg
gatctgatcactatggcgaaaagcctggcgggcggtatgccgctgtcggcggtggccggc
cgtgccgacgtgatggacgccccggcgccgggcgggctgggcggcacttatgccggtaac
ccgctggcggtggctgcggcacttgcggtgctggacgtgattgacgaagaacagctgtgc
cagcgttcccaacgtttgggccagcatttggtggaggtgctgcaacaggcgcgcaaaacc
agcccggcgatcgcggatattcgcgcgcagggatcgatggtggcggtggagttcaaggat
ccggcgaccggcaagccttcggcggagatcacccgtcaggtacagcagaaggcgctggag
gaggggctgttgctgttgagctgcggtgtgaacggtaacgtgatccgcttcctgtatccg
ctgaccatccctgaggagcagttcacccaggcgctgggcattctttcccgcgcgttggcc
caataa

DBGET integrated database retrieval system