KEGG   Streptomyces reticuli: TUE45_05290Help
Entry
TUE45_05290       CDS       T04246                                 

Gene name
glpD_3
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
srw  Streptomyces reticuli
Pathway
srw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TUE45_05290 (glpD_3)
Enzymes [BR:srw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TUE45_05290 (glpD_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: CUW30557
UniProt: A0A0U5LS03
LinkDB All DBs
Position
I:5930765..5932471
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAQRAEALAAMAERELDVLVVGGGVVGAGTALDAVTRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSMARGHGRGLPLHRHLTRRHALRVAPCLRKDALVGALQYYDAQMDDARF
VATLVRTAASYGAKAANRARVTGFLREGERVVGARVQDVEAGGEYEIRAQQVVNATGVWT
DDTQAMVGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIVGTTD
TEWDLDKAHPAASSADIDYLLEHVNSVLAVPLARDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPAPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDMRVADCVTEETPLLGAEGYQAL
WNARARIAARTGLHVVRVEHLLNRYGSLAEEVLDLIAADPSLGEPLHAADDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSAREAAELMAPVLGWDKGQIEREVEHYEKRV
EAERESQLQPDDQTADAARLGAPDIVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgactctggggccggcgcagcgcgccgaggcactggcggcgatggcggag
cgcgagctggacgtgctggtggtcggcggcggagtggtgggcgccggtaccgcgctggac
gccgtcacccgcggcctgtccaccggtttggtcgaggcccgcgactgggcctccggcacc
tccagccggtccagcaaactgatccacggcggcctgcgctatctggagatgctcgacttc
gccctggtccgcgaggccctcaaggagcgcggcctgctgctggagcgcctcgccccgcac
ctggtcaaaccggtgccgttcctctacccgctccagcacaagggctgggagcggctgtac
gcgggctcgggcgtcgcgctgtacgacgcgatgtccatggcccgcggccacggccggggc
ctgcccctgcaccgccacctgacccgccgtcacgccctgcgggtcgccccctgcctgcgg
aaggacgccctggtcggcgccctgcagtactacgacgcgcagatggacgacgcccgcttc
gtggccaccctggtgcgcacggcggcgtcctacggcgcgaaggcggccaaccgcgcgcgc
gtgaccggtttcctgcgcgagggcgagcgggtcgtcggcgcccgggtgcaggacgtggag
gccggcggcgagtacgagatccgcgcccagcaggtcgtcaacgccaccggtgtgtggacc
gacgacacgcaggccatggtgggcgagcgcggacagttccacgtccgcgcctccaagggc
atccacctggtcgtgcccaaggaccgcatccactccaccaccggtctgatcctgcgcacc
gagaagtccgtcctgttcgtcatcccctgggggcggcactggatcgtcggcaccaccgac
accgagtgggacctggacaaggcccacccggccgcgtccagcgcggacatcgactacctg
ctggaacacgtcaactcggtgctcgccgtaccgctcgcccgcgacgacgtgcagggggtg
tacgccgggctgcggccgctgctggccggcgagtccgacgccaccagcaagctgtcccgc
gagcacacggtcgcccatccggcgccgggtctggtggtcgtggcgggcggcaagtacacc
acctatcgggtcatggccaaggacgccgtcgacgaggccgtgcacggcctggacatgcgc
gtcgccgactgcgtgacggaggagaccccgctgctcggcgcggagggctaccaggccctg
tggaacgcgcgagcgcggatagccgcccgtaccggactgcacgtggtccgggtggagcac
ctgctgaatcggtacggctcgctggccgaggaggtcctggacctcatcgccgccgacccc
tcgctcggcgagccgctgcacgccgccgacgactatctgcgtgccgaggtggtgtacgcc
gcctcgcacgagggcgcccggcacctggacgacgtcctcacccgccgcacccgcatctcc
atcgagaccttcgaccggggcacccgcagcgcccgcgaggccgccgagctgatggccccg
gtcctcggctgggacaagggccagatcgaacgggaggtcgagcactacgagaagcgggtc
gaggccgagcgcgagtcccagctccagccggacgaccagacggccgacgcggcgcggctg
ggggcaccggacatcgtgccgctgtga

DBGET integrated database retrieval system