KEGG   Sinocyclocheilus rhinocerous: 107720239Help
Entry
107720239         CDS       T04916                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00590  Arachidonic acid metabolism
srx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107720239
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107720239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 107720239
NCBI-ProteinID: XP_016383363
LinkDB All DBs
Position
Unknown
AA seq 643 aa AA seqDB search
MLLCLACEDKRHGIIYLECFASLTPLLNSSYCNHILYLLLFVFQTTMKAFSFLLKWTFIL
LLSLSLCVGEESPTSSNIVNPCCYYPCQNRGICVRYGLDRYECDCTRTGFYGENCTIPEF
WTRVYRLLKPSPNIVHYILTHFDWLWDIINRTFLRDWLMHKVLTVRANLIPSPPTYNSKY
DYLNWEAYSNITYYTRILPPVPQDCPLPMGTKGKMKLPDPKLLAEKFLLRRNFRPDPQGT
NLMFAFFAQHFTHQFFKTHNHIGLGFTKGLAHGVDAGHVYGDTLDRQLDLRLHKDGKLKY
QVVNGEMYPPTVLDAPVKMSYPPSVPPEQQLAIGQEVFGLLPGLSMYATLWLREHNRVCD
ILKQEHPTWGDEQLFQTTRLIIIGETIRIVIEDYVQHLSGYRLKLNFDPTLLFTSQFQYQ
NRIAVEFNQLYHWHPLMPDSFQIDGEDIHYPQFIFNTSVLTHYGVEKLVEAFSTQPAGQI
GGGHNIHPVVLKVAEGVIIESRELRLRPFNEYRKRFNLKPYTSFSELTGEEEMAKELEEL
YGDIDALEFYPALLLENTRSGAIFGESMVEMGAPFSLKGLMGNPICSPEYWKPSTFGGKT
GFDIVNSATLKKLVCLNTKWCPYVSFHTPPPEYKHQRTSHGEL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcttttatgtcttgcatgtgaagataaacgacatggaattatttatttggagtgtttt
gcttctttaacaccacttttgaattcttcgtattgtaatcatattttgtatttattactt
tttgtcttccaaactacaatgaaagcgtttagctttttactgaagtggacgtttatcctg
ctgctgagtctctccttatgtgttggtgaagaaagcccaacttcatcaaacattgtgaat
ccttgttgctattacccttgtcaaaaccgagggatttgtgttcgatatggcctggacaga
tatgaatgtgactgcaccagaacaggcttctatggggaaaattgcactatacctgagttc
tggactagagtctatcggctcctgaagcccagtcctaatattgtccactatatcctcacc
cactttgactggctatgggacatcatcaacaggacgttcctcagggattggctcatgcac
aaagtgctcacagtgagagccaacttaatcccaagtcccccgacgtacaattccaaatat
gactacttgaactgggaagcgtattccaacatcacctactacacaagaattcttccccca
gtccctcaggactgccccttgccaatgggaaccaaaggaaaaatgaagcttccagacccc
aagcttctggcagagaagttcctgttaaggcggaatttcagaccagacccacagggaaca
aatttaatgtttgcatttttcgctcagcacttcacgcaccagttttttaagactcacaac
cacattggacttgggttcacaaaaggtctggctcatggggtggatgctggacacgtttat
ggagatactcttgatcgccagctggacctcagactgcacaaagacgggaagttgaagtac
caggtggtcaatggtgagatgtatccccccacagtgctagatgcaccggtcaaaatgagc
tacccgccgtctgtcccaccggagcagcagctggccattgggcaagaagtgtttggcctg
ctgccgggtctcagtatgtacgccaccttgtggctgcgtgagcacaaccgtgtgtgtgat
atcctgaaacaagaacatcctacctggggggatgagcagctgtttcagaccaccaggctc
attattataggtgagaccattcgtattgtgatcgaggactatgtgcagcatctgagtggt
taccggctgaagctcaactttgatcccacgctgctgttcacctcacagttccagtaccag
aaccgcattgctgtggagttcaatcagctttaccactggcacccgctcatgcctgacagc
ttccaaatcgatggagaagacattcactaccctcagttcattttcaacacctctgtcctc
acccactacggggtggagaaactggttgaggccttctcaacccaacccgcgggacagatt
ggaggtggtcataatattcacccagtggtgctcaaagtagctgagggggtcatcattgaa
tcaagggagcttcgacttcggccctttaatgaatatcgcaagagattcaatctgaaaccc
tacacgtcattctcagaattgacaggagaagaagagatggctaaagaactagaggaactg
tatggtgatattgatgctctggagttctacccagctcttttgctagagaatacacgatct
ggtgcgatatttggtgaaagcatggtggaaatgggggccccattttccctaaaaggcctc
atgggaaatcctatttgctcccctgagtactggaagcccagtacatttggggggaagaca
ggttttgatatagtaaactctgctactttgaagaaactggtttgcctcaatacaaaatgg
tgtccgtatgtgtctttccatactcctccaccagaatataaacaccagaggacatctcac
ggtgaactttag

DBGET integrated database retrieval system