KEGG   Sinocyclocheilus rhinocerous: 107756685
Entry
107756685         CDS       T04916                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107756685
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107756685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:srx04052]
    107756685
   00536 Glycosaminoglycan binding proteins [BR:srx00536]
    107756685
Cytokines and growth factors [BR:srx04052]
 Growth factors
  Growth factors (RTK binding)
   107756685
Glycosaminoglycan binding proteins [BR:srx00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107756685
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107756685
NCBI-ProteinID: XP_016429374
UniProt: A0A673JKM6
LinkDB
Position
Unknown
AA seq 147 aa
MTEADPAVKHNPPDYKKRTRLYCMNGGFHLQMLEDGTVAGAREEDIYSILRIKATSPGVV
VIEGAETGLYLSMNEDGKLYASSLVTDESYFLERMEENHYNTYQSQKHGENWYVGIKKNG
KMKRGPRTHIGQKAVFFLPRQVDQTKD
NT seq 444 nt   +upstreamnt  +downstreamnt
atgactgaggccgatcctgcggtgaaacacaacccgcccgactataagaagcggacgcgg
ctgtactgcatgaacggaggatttcacctgcagatgctggaggacgggaccgtcgcggga
gcgcgtgaggaagacatctacagcatactgcgcataaaagcaactagtccaggagtggtg
gtcattgagggagcagagacaggactttacctctctatgaatgaagacggcaagctgtat
gcttcatcattagtaacagatgaaagttatttcttggagaggatggaggaaaaccactac
aacacgtatcagtctcaaaagcacggtgaaaactggtacgtcgggataaaaaagaacgga
aaaatgaaacgaggcccaagaacacacattggacaaaaggctgttttctttctccctcga
caggtggaccagacaaaggactga

DBGET integrated database retrieval system