KEGG   Serratia plymuthica S13: M621_04840Help
Entry
M621_04840        CDS       T02716                                 

Definition
(GenBank) RbsB
  KO
K10439  ribose transport system substrate-binding protein
Organism
sry  Serratia plymuthica S13
Pathway
sry02010  ABC transporters
sry02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sry00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    M621_04840
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    M621_04840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sry02000]
    M621_04840
Transporters [BR:sry02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    M621_04840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3
Motif
Other DBs
NCBI-ProteinID: AGP43233
UniProt: S4YK96
LinkDB All DBs
Position
1030485..1031426
Genome map
AA seq 313 aa AA seqDB search
MRFKPLITALLVTAALGSASVVQAKELKSIGVTVGDLANPFFVQITKGAELKARELAGDK
VNVTLVSSGYDLGQQVAQIDNFIAAKVDMIILNAADSKGIGPAVKRAKDAGIVVVAVDVA
AEGADATITSDNTQAGAMACKYISDRLKEKGNVVIINGPPVSAVQNRVEGCMTELKKHPD
IKLLSYNQNAKGSREGGLEIMTSLLAANPKIDGVFAINDPTAIGADLAAKQAQRSEFFIV
GVDGSPDGEEALKRGNSLFVATPAQDPQVMAAKAVEIGYDILQGKPAPTGPVLIPVTMID
KNNIGSYKGWTVK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcaagccattgattaccgctttgttggttaccgccgcgctcggcagcgcctct
gtggtccaggcgaaagaattgaaatcgatcggggtgacggtgggcgatctggccaacccg
ttctttgtgcagatcaccaagggcgcggagttgaaagcgcgtgagctggccggtgacaag
gtgaatgtgacactggtgtcgagtggttacgatcttggccagcaggtggcgcagatcgac
aacttcatcgccgccaaggtcgatatgatcatcctcaacgccgccgattccaaaggcatc
ggcccggcggtcaaacgcgccaaggacgccggcattgtggtggtggcggtagacgtggcg
gccgaaggcgccgacgcgaccatcacttcggataacacccaggcgggtgcgatggcctgt
aaatacatcagcgatcgcctgaaagagaaaggcaacgtggtgatcatcaacgggccgccg
gtttctgcggtgcaaaaccgggtggagggctgcatgaccgagctgaagaaacacccggat
atcaagctgctgtcctataaccagaacgccaagggcagccgcgaaggcggcctggagatc
atgacctcgttgctggcggccaatccgaagatcgacggcgtattcgcgattaacgatccg
acggcgatcggcgccgatctggcggccaagcaggcgcagcgcagcgagttctttatcgtc
ggcgtagacggttcgccggacggtgaagaggcgctcaagcgcggcaactcgctgtttgtg
gcgacgccggcgcaggatccgcaggtgatggcggccaaggcggtcgagatcggttacgac
attctgcagggcaaacccgcgccaaccggcccggtgctgatcccggtgaccatgatcgat
aaaaacaatatcggcagctacaaaggctggacggtgaaataa

DBGET integrated database retrieval system