KEGG   Serratia plymuthica S13: M621_22475Help
Entry
M621_22475        CDS       T02716                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sry  Serratia plymuthica S13
Pathway
sry00250  Alanine, aspartate and glutamate metabolism
sry00410  beta-Alanine metabolism
sry00640  Propanoate metabolism
sry00650  Butanoate metabolism
sry01100  Metabolic pathways
sry01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    M621_22475
   00650 Butanoate metabolism
    M621_22475
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M621_22475
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M621_22475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sry01007]
    M621_22475
Enzymes [BR:sry01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     M621_22475
Amino acid related enzymes [BR:sry01007]
 Aminotransferase (transaminase)
  Class III
   M621_22475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGP46111
UniProt: S4YNL6
LinkDB All DBs
Position
complement(4779742..4781007)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGIGVMCGFYAERAENATLWDVEGNEVIDFASGIAVLNTGHRHPK
VIAAIERQLKAFTHTAYQIVPYESYVALAERINQRAPIEGPCKTALFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNIAPADFMQALRELCDQHGILLIADEV
QTGFARTGKLFAMEHYAVKPDLITMAKSLAGGMPLSAVAGRADVMDAPAPGGLGGTYAGN
PLAVAAALAVLDVIDEEQLCQRSQRLGQHLVEVLQQARKTSPAIADIRAQGSMVAVEFKD
PATGKPSAEITRQVQQKALEEGLLLLSCGVNGNVIRFLYPLTIPEEQFTQALGILSRALA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaatcaacgtcgccaggatgccaccccacgcgggattggcgtg
atgtgcggtttttacgccgagcgtgcggagaacgccacgctgtgggacgtagaaggcaat
gaggttatcgatttcgcttccggtattgctgtcctgaataccggacaccggcatccgaag
gtgatcgccgccattgaacggcaactgaaggccttcacccacaccgcttaccaaatcgtt
ccttacgaaagctatgtcgcgttggcagagcgcatcaaccagcgcgcaccgattgaaggc
ccttgtaaaaccgccttgttcaccaccggcgcagaagcggtggaaaacgcggtcaaaatc
gcccgtgcctataccggtcggccgggcctgatcacctttggcggcggtttccatggccgc
acttacatgaccatggcgctgaccggcaaagtggcgccgtacaagctgggcttcgggccc
ttccccggttcggtgttccacggccagtatccgaatgcgctgtatggcgtgaccaccgaa
gacgcgatgaacagcctggaacgcatctttaaggcggatatcgatcccaaacaagtggcc
gccatcgtgctggagccggtgcagggcgaaggcggtttcaacatcgcgccggccgatttt
atgcaggcgctgcgcgaactgtgcgaccagcacggcattttgctgattgccgacgaagtg
cagaccggttttgcccgtaccggcaagctgtttgccatggaacattacgcggtgaaaccg
gatctgatcaccatggcgaaaagcctggcgggcggtatgccgctgtcggcggtggccggc
cgtgccgacgtgatggacgccccggcgccgggcgggctgggtggcacctatgccggtaac
ccgctggcggtggctgcggcacttgcggtgctggacgtgatcgacgaagaacagctgtgc
cagcgttctcaacgtttgggccagcatttggtggaagtgctgcaacaggcgcgcaaaacc
agcccggcgatcgcggatattcgcgcgcagggttcaatggtggcggtggagttcaaggat
ccggcgaccggcaagccttcggcggagatcacccgtcaggtacagcagaaggcgctggaa
gagggcctgctgctgttgagctgtggtgtgaacggcaacgtgatccgcttcctgtatccg
ctgaccatccctgaggaacagttcacccaggcgctgggcattctttcccgcgcgttggcc
caataa

DBGET integrated database retrieval system