KEGG   Streptococcus sanguinis: SSA_0564Help
Entry
SSA_0564          CDS       T00473                                 

Definition
(RefSeq) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00220  Arginine biosynthesis
ssa00250  Alanine, aspartate and glutamate metabolism
ssa00290  Valine, leucine and isoleucine biosynthesis
ssa01100  Metabolic pathways
ssa01110  Biosynthesis of secondary metabolites
ssa01210  2-Oxocarboxylic acid metabolism
ssa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSA_0564
   00290 Valine, leucine and isoleucine biosynthesis
    SSA_0564
   00220 Arginine biosynthesis
    SSA_0564
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssa01007]
    SSA_0564
Enzymes [BR:ssa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SSA_0564
    2.6.1.66  valine---pyruvate transaminase
     SSA_0564
Amino acid related enzymes [BR:ssa01007]
 Aminotransferase (transaminase)
  Class I
   SSA_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Aminotran_3
Motif
Other DBs
NCBI-GeneID: 4807960
NCBI-ProteinID: YP_001034557
UniProt: A3CLF2
LinkDB All DBs
Position
555834..557048
Genome map
AA seq 404 aa AA seqDB search
MKEFDKSSKLEHVAYDIRGPVLDEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKNFPNVDIDDIYLGNGVSELIVMSMQGLLDDGD
EVLVPMPDYPLWTAAVSLAGGNAVHYVCDEQAEWYPDIDDIKSKITSNAKAIIIINPNNP
TGALYPKELLLEIVEIARQNNLIIFADEIYDRMVMDGNVHTSVASLAPDIFCVSMNGLSK
SHRIAGFRVGWMVLSGPKHHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYQAIQDIPGLSAVKPKAGLYIFPKIDRNMYHIDDDEQFVLNFLKQEK
VLLVHGRGFNWKDPDHFRIVYLPRVDELAQIQEKMTRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttgacaagtccagcaagctggaacatgttgcctatgatattcgcggtcca
gttttggacgaagctatgcgcatgcgggccaatggtgaaaagattctccgcctcaataca
gggaatccggctgaatttggttttaccgctccagatgaggtcattcatgatttgattatg
aatgcgcgtgacagtgagggctactctgattccaagggaattttttcagcccgtaaggct
atcatgcagtattgtcagcttaagaattttcctaatgtagatattgatgatatttatctg
ggaaatggtgtcagcgagctgattgtcatgtccatgcagggcttgcttgatgacggggac
gaggtgctggtgccgatgccagactatccactctggacggctgcagtcagtctggctggt
gggaatgctgttcactatgtttgtgatgagcaggcagaatggtatccagatattgacgat
atcaagtcaaaaatcacatctaatgccaaggctatcattatcattaaccctaacaatcca
acgggagcactttatcctaaggaactgctgctggagattgtggaaattgctcgtcaaaat
aatctcattatctttgcggatgaaatttatgaccgcatggtgatggatggcaatgtccat
acgtctgtggctagtctggctcctgatatcttctgtgtcagcatgaatggtctttccaag
tcgcaccgcatcgcaggcttccgtgttggttggatggtgctatctggacctaagcatcat
gttaagggttatattgaagggttgaacatgctctccaatatgcgcctgtgctccaatgtc
ttggctcaacaggtcgtccaaacctcacttggcggtcaccaatctgtggatgaactgctt
ttgccaggtggtcgtatctatgaacagcgtaatttcatctatcaggctattcaggacatc
ccgggactgtcagctgtaaaacctaaagctggtctctatattttcccgaaaattgaccgg
aacatgtatcatatcgacgatgatgagcagtttgtgctcaatttcctcaagcaggaaaaa
gtccttctcgtccatggacgaggctttaactggaaagacccagatcatttccgaatcgtt
tatctgcctcgagtagatgagctagctcaaatccaagaaaaaatgacgcgcttcttgcgc
caatatcgccgttaa

DBGET integrated database retrieval system