KEGG   Streptococcus sanguinis: SSA_1225Help
Entry
SSA_1225          CDS       T00473                                 

Gene name
ilvE
Definition
(RefSeq) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00270  Cysteine and methionine metabolism
ssa00280  Valine, leucine and isoleucine degradation
ssa00290  Valine, leucine and isoleucine biosynthesis
ssa00770  Pantothenate and CoA biosynthesis
ssa01100  Metabolic pathways
ssa01110  Biosynthesis of secondary metabolites
ssa01210  2-Oxocarboxylic acid metabolism
ssa01230  Biosynthesis of amino acids
Module
ssa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ssa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ssa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SSA_1225 (ilvE)
   00280 Valine, leucine and isoleucine degradation
    SSA_1225 (ilvE)
   00290 Valine, leucine and isoleucine biosynthesis
    SSA_1225 (ilvE)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SSA_1225 (ilvE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssa01007]
    SSA_1225 (ilvE)
Enzymes [BR:ssa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     SSA_1225 (ilvE)
Amino acid related enzymes [BR:ssa01007]
 Aminotransferase (transaminase)
  Class IV
   SSA_1225 (ilvE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-GeneID: 4806176
NCBI-ProteinID: YP_001035179
UniProt: A3CN74
LinkDB All DBs
Position
complement(1247679..1248698)
Genome map
AA seq 339 aa AA seqDB search
MTVNLDWENLGFSYMKLPYRYLAYYRNGQWEEGTLTEDATLHISESSPCLHYGQQAFEGL
KAYRTKDGSIQLFRPDKNAERLQRTADRLLMPQVPTEMFVDAVKQVVRANEEYVPPYGTG
GTLYIRPLLIGVGDIIGVKPAEEYIFTIFVMPVGNYFKGGLTPTNFIVSDDYDRAAPHGT
GAAKVGGNYAASLLPGKIAKDKHFSDVIYLDPATHTKIEEVGSANFFGITKDNEFVTPLS
PSILPSITKYSLLYLAEHRLGLKPIEGDVPLADLGKFTEAGACGTAAVISPIGGIQHGND
FHVFYSETEVGPVTRKLYDELTGIQFGDVEAPEGWIVKV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaatcttgactgggaaaatctaggattctcatatatgaaactaccgtatcgc
tatttagcttactatcgcaatggccagtgggaagaaggaacgttaactgaggacgctacg
ctccatatttctgagtcgtctccttgccttcactacggtcagcaggcttttgagggtctg
aaggcttatcgaactaaggacggcagcattcaactcttccgtccggataaaaatgcggag
cgtttacagcggacagctgatcgcttgctcatgccgcaggttccaacagaaatgtttgtg
gatgcagttaagcaggttgtccgagctaatgaagaatatgttccaccttatggaacaggc
ggaaccctttatattcgacctctcttgattggagtcggcgatattatcggcgtaaaacca
gctgaagaatacattttcactatctttgtaatgccggtcggcaattacttcaaaggcggc
ctgactccgactaacttcattgtctcagatgactatgaccgcgcggcaccacatggaact
ggtgcggctaaagttggaggcaattacgctgctagcttattaccaggaaagattgctaag
gataagcatttttcagatgtgatttatctggatccagcaacccataccaagattgaagaa
gtgggatctgccaacttctttggaatcaccaaggataatgagtttgtaacgcctctcagt
ccgtctatcttgccatccatcaccaagtactctttgctttatctggccgagcatagacta
gggcttaagccgattgagggagatgttccactggcagacttgggtaaattcactgaagct
ggcgcttgtggaacagctgcagtcatctctcctatcggtggtatccagcacggcaatgat
ttccatgtcttctatagcgagacggaagttggtccagtcactcgcaagctatatgacgaa
ttaactggtatccaattcggcgatgttgaagcgccagaaggttggattgtaaaagtataa

DBGET integrated database retrieval system