KEGG   Sphingomonas sanxanigenens: NX02_18970Help
Entry
NX02_18970        CDS       T03929                                 

Definition
(GenBank) hypothetical protein
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00621  Dioxin degradation
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
ssan01220  Degradation of aromatic compounds
Module
ssan_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    NX02_18970
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     NX02_18970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigB
Motif
Other DBs
NCBI-ProteinID: AHE55458
UniProt: W0AGQ2
LinkDB All DBs
Position
4009435..4010244
Genome map
AA seq 269 aa AA seqDB search
MGKIVGAFAMSHQLGSPAGVEEQSERVFQGMREIGRRIRALDPDVLVIITSDHLSNFSLT
TPAPFAVGTAAAFHPLGDMGLPRDPVPGAPGFAEGLLAFAQERGVAIDRADPIQPDHGVM
IPLGIVDPERRFPAVPLYVNTVFYPEPRPADCRRLGELVRDYVTQSPDGARVVLLAGGGL
SHWVGTPQEGAVNAPWDRAFLADMLAGDLDALAARDNATILDVAGNGGLEVNAWIVLAAA
VPGARGECLFYEAMPTWATGMAGVEMRLG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcgtcggcgccttcgccatgtcgcaccagctcggttcgcccgcgggggtc
gaggaacagtcggagcgcgtcttccagggcatgcgcgagatcggccgccgcatccgcgcg
ctcgatccggacgtgctggtgatcatcaccagcgaccatctcagcaatttctcgctgacc
accccggcgcccttcgcggtcggcaccgcggcggcgttccacccgctcggcgatatgggc
ctgccgcgcgatccggtgccgggcgcgcccggattcgccgaggggttgctcgcgttcgcg
caggaacggggtgtggcgatcgaccgcgccgatcccatccagccggatcatggcgtgatg
atcccgctcggcatcgtcgatcccgagcgccggttcccggcggttccgctctacgtcaac
accgtcttctaccccgagccccgccccgccgattgccgccggctgggcgaactggtgcgc
gattatgtgacccaatcgccggacggcgcgcgcgtcgtgctgctggcgggcggcggcctg
tcccactgggtcggcacgccgcaggaaggcgcagtcaacgcgccctgggaccgggccttc
ttggcggacatgctcgcaggcgacctcgacgcgctggccgcccgcgacaatgcaacgatc
ctcgacgtggccggcaatggcgggctggaagtgaatgcgtggatcgtcctcgccgcggcc
gtacccggcgcacgcggcgaatgcctgttctatgaggcgatgccgacatgggcgacgggc
atggccggggtggagatgcggctgggctga

DBGET integrated database retrieval system