KEGG   Sphingomonas sanxanigenens: NX02_24275Help
Entry
NX02_24275        CDS       T03929                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ssan  Sphingomonas sanxanigenens
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NX02_24275
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NX02_24275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like AlaDh_PNT_C DAO Glutaredoxin FAD_binding_3 NAD_binding_7 K_oxygenase Thi4 FMO-like NAD_binding_8 YojJ
Motif
Other DBs
NCBI-ProteinID: AHE56462
UniProt: W0AIS0
LinkDB All DBs
Position
complement(5098586..5100166)
Genome map
AA seq 526 aa AA seqDB search
MLDANLKQQLKAYLGNITQPIELVASLDDSDKSREMLALLEDIAGLSEKVAVVRTDGDKR
TPSFMIRRVGTDIGVRFAGLPMGHEFTSLVLALLQVGGHPSKAAQELIQQVKDLDGDYAF
ETYFSLSCQNCPDVVQALNLMAVLNPRISHVAIDGALFQDEVTERKVMAVPTVFLNGEPF
AQGRMELEQIVAKIDSGASARAAEKIKAKDPFDVLVIGGGPAGAAAAIYAARKGIRTGIA
AERFGGQVLDTMGIENFISVQHTEGPKLAAQLEQHVKDYDVDIMNLQRAEKLITARVPGG
LHEVRLENGASLKARTIILSTGARWRQMGVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSDLRADAVLQRKLASLANVKIITSALTTEVLGDG
EKVVGLTYKDRNHDSLHQIELEGIFVQIGLVPNTEWLRDAIALSPRGEIEIDHRGETSKP
GVFAAGDVTTVPYKQIVIAMGEGSKAALSAFDYMIRLAPAEEAAAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcgaatctcaagcagcagttgaaggcctatctcggcaacatcacccagccg
atcgagctggtggcgtcgctggacgatagcgacaagtctcgcgaaatgctcgccctgctg
gaggacatcgccggcctgtccgaaaaggtcgcggtcgtccgcacggatggcgacaagcgc
acccccagtttcatgatccggcgcgtcggcaccgatatcggcgtgcgtttcgccggtctg
ccgatgggccacgaattcacctcgctcgtgctcgccctgctgcaggtcggcggtcatccg
tcgaaggccgcgcaggaactgatccagcaggtgaaggacctcgacggcgattatgccttc
gaaacctatttctcgctctcctgccagaactgcccggatgtcgtgcaggcgttgaacctg
atggcggtgctcaacccgcggatcagccatgtcgcgatcgatggcgccctgttccaggat
gaagtgaccgagcgcaaggtgatggcggttcccaccgtcttcctcaatggcgagcccttc
gcccaggggcggatggagctcgagcagatcgtcgccaagatcgacagcggtgcttccgcg
cgtgctgccgagaagatcaaggcgaaggacccgttcgacgtgctcgtgatcggcggcggt
cccgccggtgccgcggcggcgatctatgccgcgcgcaagggcatccgcaccggcatcgcc
gccgagcggttcggcgggcaggtgctcgacacgatgggcatcgagaatttcatctcggtg
cagcacactgaagggcccaagctggccgcgcagctcgaacagcatgtgaaggattatgat
gtcgacatcatgaacctgcagcgcgccgaaaagctgatcacggcgcgcgtgcccggcggc
ctgcacgaggtgcggcttgagaacggcgcgtcgctgaaggcccgcaccatcatcctgtcg
accggtgcccgctggcggcagatgggggtgccgggcgaggaccagtatcgcaacaagggc
gtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattccggtgtcgaggcggcgatcgacctcgccggcatcgtcgcgcacgtg
acgctgatcgagttcgacagcgacctgcgggcggatgcggtgctccagcgcaagctggcc
agcctggccaacgtcaagatcatcacctcggcgctgaccaccgaggtgctgggggatggc
gagaaggtggtgggcctgacctacaaggaccgcaaccatgacagcctccaccagatcgag
ctggagggcatcttcgtccagatcggcctggtgccgaacacggagtggctgagggacgcg
atcgcgctttcgccgcgcggcgagatcgagatcgatcatcgcggcgaaacctccaagccc
ggcgtgttcgcggcgggtgacgtgaccacggtgccctacaagcagatcgtgatcgcgatg
ggcgaaggctcgaaggcggcgctctcggcgttcgactatatgatccggctcgcgccggcc
gaggaagccgccgcggcctga

DBGET integrated database retrieval system