Sus scrofa (pig): 100516396 Help Entry 100516396         CDS       T01009                                  Symbol CCL16 Name (RefSeq) C-C motif chemokine 16   KO K21093   C-C motif chemokine 16 Organism ssc  Sus scrofa (pig) Pathway ssc04060   Cytokine-cytokine receptor interaction ssc04061   Viral protein interaction with cytokine and cytokine receptor ssc04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100516396 (CCL16)    04061 Viral protein interaction with cytokine and cytokine receptor     100516396 (CCL16)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     100516396 (CCL16)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssc04052]     100516396 (CCL16) Cytokines and neuropeptides [BR:ssc04052]  Cytokines   Chemokines    100516396 (CCL16) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100516396 NCBI-ProteinID:  XP_003131762 LinkDB All DBs Position 12:39618187..39621557 Genome browser AA seq 102 aa AA seqDB search MKVSVASLFLLILILATTSALRGQERIPDWVNPPPTCCLTYHEKVLPRKLVVGYKKAFNC HLPAIIFITKRNREICTNPDDKWVQKYIKDPKLSLQPSRVSA NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgtggcttccctctttctcctcatcctcatcctcgccactacttctgct cttcgcggccaggaaagaattcctgactgggtgaaccctccacccacctgctgcctgacg tatcatgagaaggttttgccaaggaaactggtggtgggctacaaaaaggccttcaactgc cacctaccagcaatcatcttcatcaccaaacggaaccgagagatctgcaccaaccctgat gacaagtgggtccaaaagtacatcaaggatcccaaactatctttgcagccttccagggtg tcggcctag

DBGET integrated database retrieval system