KEGG   Sus scrofa (pig): 100625643
Entry
100625643         CDS       T01009                                 

Gene name
NRG2
Definition
(RefSeq) pro-neuregulin-2, membrane-bound isoform
  KO
K05456  neuregulin 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04012  ErbB signaling pathway
ssc05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100625643 (NRG2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100625643 (NRG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100625643 (NRG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    100625643 (NRG2)
Cytokines and growth factors [BR:ssc04052]
 Growth factors
  Growth factors (RTK binding)
   100625643 (NRG2)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set C2-set_2 Ig_6 EGF DUF3169 EGF_2
Other DBs
NCBI-GeneID: 100625643
NCBI-ProteinID: XP_020940538
Ensembl: ENSSSCG00000025040
LinkDB
Position
2
AA seq 859 aa
MRQVCCSALPPPPLEKARCSSYSDSSSSSSSSERSSSSSSSSESSSSRSSSSSNSSISRP
AAPPEPRPQPQPQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKS
VQDQAYKAPVVVEGKVQGLAPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQV
ISVGSCAPLERNQRYIFFLEPTEQPFVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKL
KKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFN
KVKVEDAGEYVCEAENILGKDTARGRLFVNSVSTTLSSWSGHARKCNETAKSYCVNGGVC
YYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKHLGFELKEAEELYQKRVLTITG
ICVALLVVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMA
DYISKNVPATDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTS
DSQSGIMLSSVGTSKCNSPACVEARARRAAAYSLEERRRAVGPPHHDSTDSLRDSPHSER
YVSALTTPARLSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPSSYRLAEQQPLLRHP
APVGPDAGPGPGADMQRSYDSYYYPAAGPGPRRGACALGGSLGSLPASPFRIPEDDEYET
TQECAPPPPPPPPPRPRARGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSGG
GSASASDDDADDADGSLAAESTPFLGLRAAHDALRSDSPPLCPAADSRTYYSLDSHSTRA
SSRHSRGPPPRAKQDSAPL
NT seq 2580 nt   +upstreamnt  +downstreamnt
atgcggcaggtttgctgctcagcgctgccgccgccgccactggagaaggctcggtgcagc
agctacagcgacagcagcagcagcagcagcagcagcgagaggagcagcagcagcagcagc
agcagcgagagcagcagcagcaggagcagcagcagcagcaacagcagcatctcccgtccc
gctgcgcccccagagccgcggccgcagccacagccgcagccccgcagccccgcagcccgg
agagccgccgcccgctcgcgagccgcagccgccggcggcatgaggcgcgacccggccccc
ggcttctctatgctgctcttcggtgtgtcgctcgcttgctactcgcctagcctcaagtca
gtgcaggaccaggcgtacaaggcacccgtggtggtggagggcaaggtacagggactggcc
ccggccggcggctccagctccaacagcacccgcgagccgcccgcctcgggtcgggtggcg
ctggtgaaggtgctggacaagtggccgcttcggagtgggggactgcagcgcgagcaggtg
atcagcgtgggctcctgtgcgccgctcgaaaggaaccagcgctacatctttttcctggag
cccacggagcagcccttcgtctttaagacagcctttgcccccctcgacaccaacggcaaa
aacctcaagaaagaggtgggcaagatcctgtgcactgactgcgccacccggcccaagctg
aagaagatgaagagccagacgggacaggtgggcgagaaacaatcgctcaagtgcgaggca
gcagccgggaacccccagccctcctaccgctggttcaaggacggcaaggagctcaaccgc
agccgcgacattcgcatcaagtacggcaacggcagaaagaactcgcgactgcagttcaac
aaggtgaaggtggaggacgccggggagtacgtgtgcgaggcggagaacattctggggaag
gacacggcccggggccggctcttcgtcaacagcgtgagcaccaccctgtcatcctggtcg
gggcacgcccggaagtgcaacgagaccgccaagtcctactgcgtcaacggcggggtctgc
tactacatcgagggcatcaaccagctctcctgcaaatgtccaaacggattcttcggacag
agatgtttggagaaactgcctttgcgattgtacatgccagatcctaagcaaaagcacctt
ggatttgaactaaaggaggccgaggagctgtaccagaagagggtcctgaccatcaccggc
atctgcgtggctctgctggtcgtgggcatcgtctgcgtggtggcctactgcaagaccaaa
aaacaacggaagcagatgcacaaccacctccggcagaacatgtgcccagcccaccagaac
aggagcctggccaacgggcccagccacccccgcctggaccctgaggagatccagatggca
gactatatctccaagaacgtgccagccacggaccacgtcatccggagggaaacggagacc
accttctccgggagccactcctgctctccttctcaccactgctccaccgccacgcccacc
tccagccacaggcatgagagccacacgtggagcctggaacgttctgagagcctgacctca
gactcacaatcgggcatcatgctgtcatcagtgggcaccagcaaatgcaacagccccgcg
tgtgtggaggctcgggcgcggcgggcagcagcctacagcctggaggagcggcgccgggca
gtggggccccctcaccacgactccacagactccctgcgtgactccccgcacagtgagagg
tacgtgtcggccctgaccacgcccgcgcgcctctctcccgtggacttccattactcgctg
gccacgcaggtgcccactttcgagatcacgtcacccaactcggcgcacgccgtgtcgctg
ccgccggccgcgcccagcagctaccgcctggcggagcagcagccactccttcggcacccg
gcgcccgtgggccccgacgcggggcccgggcccggcgcggacatgcagcgcagctacgac
agctactactaccccgcggcggggcccgggccgcggcgcggggcctgcgcgctgggcggc
agcctgggcagcctgcccgccagccccttccgcatcccggaggacgacgagtacgagacc
acgcaggagtgcgcgcccccgccgccgccgccgccgccgccgcggccccgcgcccgcggc
gcgtcccgcaggacgtcggcggggccccggcgctggcgccgctcgcgcctcaacgggctg
gcggcgcagcgcgcacgcgcggcgcgggactcgctgtcgctgagcagcggctcgggcggc
ggctcggcctccgcctcggacgacgacgcggacgacgcggacggctcgctggcggccgag
agcacgcccttcctcggcctgcgcgcggcgcacgacgcgctgcgctcggactcgccgccg
ctgtgcccggcggccgacagcaggacttactactccctggacagccacagcacgcgggcc
agcagcagacacagccgcgggccgcccccgcgggccaagcaggactcggcgcccctctag

DBGET integrated database retrieval system