KEGG   Sus scrofa (pig): 396740
Entry
396740            CDS       T01009                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    396740 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    396740 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ssc03310]
    396740 (NR3C1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    396740 (NR3C1)
Nuclear receptors [BR:ssc03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   396740 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 396740
NCBI-ProteinID: NP_001008481
Ensembl: ENSSSCG00000014401
UniProt: Q9N1U3
LinkDB
Position
2
AA seq 782 aa
MDPKESLTPPSREEIPSSVLGRERAHVMDFYKSLRGGTPVKVSAASPSLAAVSQPDSKQQ
RLAVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGSDLGFPQQGQISLSSGETDF
RLLEESIANLSRSTSVPENPKSSASAAGPAAPAEKAFPKTHSDGAPEQPNVKGQTGTNGG
NVKLFTTDQSTFDIWRKKLQDLELPSGSPGKETSESPWSSDLLIDENCLLSPLAGEEDPF
LLEGSSTEDCKPLVLPDTKPKVKDNGELILPSPNSVPLPQVKTEKEDFIELCTPGVIKQE
KLGPAYCQASFSGANIIGGKMSAISVHGVSTSGGQLYHYDMNTAASLSKQQEQKPLFNVI
PPIPVGSENWNRCQGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAATG
PPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPA
CRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENSANKTIVPATLPQLTPTLVSL
LEVIEPEVLYAGYDSSIPDSTWRIMTALNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTL
LQYSWMFLMVFALGWRSYRQSSASLLCFAPDLVINEQRMALPCMYDQCRHMLYVSSELQR
LQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRF
YQLTKLLDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQLPKYSSGNIKKLLFH
QK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggaccccaaggaatcgctgaccccccccagcagagaagaaatccccagcagcgtgctt
ggccgggagagagcccatgtgatggacttctataaaagcctgaggggaggaactcctgtg
aaggtttctgcagcttcaccctccctggctgctgtgtctcagccagactccaagcagcag
aggcttgcggtggactttccaaaaggctcaggaagcaatgcacagcagccagatctgtcc
aaggcagtttcactctccatgggactgtacatgggagagaccgaaactaaagtgatggga
agtgacctgggattcccacagcagggccaaatcagcctttcctctggggagacagacttc
cggcttctggaagaaagcatcgcaaacctcagtaggtcgaccagtgttccagagaacccc
aagagttcagcctccgctgctggtcctgctgctccggcagagaaggcgtttccaaaaacc
cactctgatggggctccagagcagccgaatgtgaagggtcagactggcaccaacgggggt
aacgtgaagttgtttaccacagaccaaagcacctttgacatttggaggaagaaactccag
gatttggagcttccttctgggtctccaggtaaagagacaagtgagagtccctggagctcg
gacctcttgatcgatgaaaactgtttgctctcccctttggcaggagaggaggatcccttc
ctcttggaaggaagctcgaccgaggactgtaagcctcttgttttgccggacacgaaacct
aaagtgaaggataacggagagcttatcttaccgagccccaacagtgtgccactgccccaa
gtgaaaacagaaaaagaagattttatcgaactctgcaccccaggggtgattaagcaggag
aaactgggcccagcctactgtcaggcgagcttttctggggcaaacataattggtggtaaa
atgtctgccatttctgttcacggggtgagcacctcggggggacagctgtaccactatgac
atgaacacggcagcatccctttccaaacagcaggagcagaaacctctttttaatgtcatt
cccccgattcctgtgggttcagaaaattggaatagatgccaaggatctggagacgataac
ttgacttccttggggactttgaacttctctggccgatcagttttttcgaatggctactca
agccctggaatgagaccggacgtaagttctcctccatcgagctcctcagcagcaacggga
ccacctcccaaactctgccttgtgtgttctgatgaagcttcgggatgtcattatggggtc
ctgacttgtggaagctgtaaagtattcttcaaaagagcagtggaaggacagcacaattat
ctttgtgctggaagaaatgactgtatcattgataaaattcgaagaaaaaactgtccagca
tgccgctacagaaagtgtcttcaagctggaatgaacctggaagctcgaaaaacaaagaaa
aagataaaaggaattcagcaggccactacaggagtctcacaagaaacttctgaaaattct
gctaataaaacaatagttcctgcaacgctaccacagctcacccccaccctggtgtcactg
ctggaagtcattgaacccgaggtgttgtatgcaggatatgacagctcgattccagattcc
acctggcggatcatgaccgcactcaacatgttaggcgggcggcaggtgattgcagcagtg
aaatgggcaaaggcaataccaggattcaggaacttacacctggatgaccaaatgaccctc
ctgcagtattcatggatgtttctcatggtgttcgccctggggtggagatcatacagacaa
tcaagtgccagcttgctgtgttttgctcctgatctggttattaatgagcagagaatggct
ttaccctgcatgtatgaccaatgtagacatatgctgtatgtttcctctgagttacagagg
cttcaggtgtcttacgaagagtatctctgtatgaaaaccttactgcttctctcttcagtt
cccaaggacggtttgaagagtcaagagctatttgatgaaattagaatgacctacatcaaa
gagctaggaaaagccattgtcaagagggaaggaaactccagtcagaactggcaacgcttt
tatcaactgacaaaactcttggactccatgcatgatgtggttgaaaatctccttaactat
tgcttccagacatttttggataagaccatgagtattgaattcccagagatgttagctgaa
atcatcactaatcagttaccaaaatactcaagtggaaatatcaaaaaacttctgtttcat
caaaagtga

DBGET integrated database retrieval system