KEGG   Sus scrofa (pig): 397541Help
Entry
397541            CDS       T01009                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00590  Arachidonic acid metabolism
ssc01100  Metabolic pathways
ssc04611  Platelet activation
ssc04726  Serotonergic synapse
ssc04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    397541 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    397541 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    397541 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    397541 (PTGS1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     397541 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 397541
NCBI-ProteinID: XP_001926164
Ensembl: ENSSSCG00000005533
LinkDB All DBs
Position
1
AA seq 600 aa AA seqDB search
MSLRSLSLWFPLLLLLLPPPPALPEDPRAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCT
RTGYSGPNCTIPELWTWLRTSLRPSPSFFHFLLTHGRWFWEFVNATFIRDMLMRLVLTVR
SNLIPSPPTYNTAHDYISWESFSNVSYYTRILPSVPQDCPTPMGTKGKKQLPDAELLSRR
FLLRRKFIPDPQGANLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYHLRLFKDGKLKYQVLNGEMYPPSVEEAPVLMHYPRGVPPRSQMAMGQEVFGLLPGLML
YATLWLREHNRVCDLLKAEHPTWDDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFGVQFQYRNRIAVEFNQLYHWHPLMPNSFRVGPQDYSYEQFLFNTSMLMDYGVE
ALVDAFSRQIAGRIGGGRNMDHHVLHVAVGLIKDSRELRLQPFNEYRKRFGLKPYTSFQE
LTGEKEMAAELEELYGDIDALEFYPGLLLEKCLPNSIFGESMIEIGAPFSLKGLLGNPIC
SPQYWKASTFGGEMGFNLVKTATLRKLVCLNTKTCPYVAFRVPDLRQEDGPGVERPSTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcggagtctctcgctgtggttcccgctgcttctgctgctgctgccgccaccc
ccggccctgcccgaggacccccgggcgcctgcaccggtgaacccctgttgttactatccg
tgccagcaccagggtatctgtgtccgctttggccttgaccgctaccagtgtgactgcacc
cgcacgggctactctggccccaactgcaccatccctgagctgtggacctggctccggact
tctttgcggcccagcccctctttcttccacttcctgctgacgcatgggcgctggttctgg
gagtttgtcaatgccaccttcatccgcgacatgctcatgcgcctggtactcacagtgcgt
tccaaccttatccccagcccccccacctacaacacggcacacgactacatcagctgggag
tccttctccaatgtgagctactacacgcgaattctgccctctgtgccccaagactgcccc
acgcccatggggaccaaagggaagaagcagttgccagatgctgaactcctgagccgtcgc
ttcctactccggaggaagttcatacctgacccccagggcgccaacctcatgtttgccttc
tttgcccaacacttcacccaccagttcttcaagacttctggcaagatgggtcctggcttc
accaaggcgttgggccacggggtagacctcggccacatttatggagacaatctggaacgt
cagtatcacctacggctctttaaggatgggaaactcaagtaccaggtgctgaatggagag
atgtatccgccgtcggtggaagaggcaccggtgctgatgcattatcctcggggcgtccca
cctcggagccagatggccatgggccaggaggtgtttgggctgcttcctgggctcatgctc
tatgccaccctctggctgcgcgagcacaaccgtgtgtgtgacctgctgaaggctgagcac
cccacctgggacgacgagcagctcttccagacggcccgcctcatcctcatcggggagacc
atcaagatcgtgattgaggagtacgtgcagcagctgagcggctacttcctgcagctcaag
tttgacccggagctgctgttcggcgtccagttccagtaccgcaaccgcatcgccgtggag
ttcaaccagctgtaccactggcacccgctcatgcccaactccttcagggtgggcccccag
gactacagctacgagcagttcctcttcaacacctccatgctgatggactatggggtcgag
gccctggtggacgccttctcgcgccagatcgcgggccggatcggtgggggtaggaacatg
gaccaccacgtcttgcatgttgccgttgggctcatcaaggactcgcgagagctgcgccta
cagcccttcaatgagtaccgcaagcggtttggcctgaagccctacacctccttccaggag
ctcacaggagagaaggagatggcagctgagttggaggagctgtatggagacatcgatgcc
ttggagttctacccagggctgcttctcgagaagtgcctcccaaactccatctttggggag
agtatgatagaaattggggcccctttttcccttaagggcctcttagggaatcccatctgt
tcccctcagtactggaaggcgagcacgtttggtggcgagatgggcttcaaccttgtcaag
acggccacgctgaggaagctggtttgcctcaacaccaagacttgtccctacgttgccttc
cgagtgccagacctgcgccaggaggatgggcctggtgtggagcggccgtccacagagctc
tga

DBGET integrated database retrieval system