KEGG   Sus scrofa (pig): 397592
Entry
397592            CDS       T01009                                 

Gene name
JUP
Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
ssc05226  Gastric cancer
ssc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397592 (JUP)
   05202 Transcriptional misregulation in cancer
    397592 (JUP)
  09162 Cancer: specific types
   05226 Gastric cancer
    397592 (JUP)
   05221 Acute myeloid leukemia
    397592 (JUP)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    397592 (JUP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    397592 (JUP)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   397592 (JUP)
SSDB
Motif
Pfam: Arm HEAT V-ATPase_H_N Cnd1 HEAT_2 Adaptin_N Atx10homo_assoc DUF3361 KAP Arm_2 PUL
Other DBs
NCBI-GeneID: 397592
NCBI-ProteinID: NP_999488
Ensembl: ENSSSCG00000017428
UniProt: Q8WNW3
LinkDB
Position
12
AA seq 745 aa
MEVMNLIEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGLMEEDEACGRQYTLKKTTT
YTQAVPQSQGDLEYQMSTTARAKRVREAMCPGVTGEDSSLLLATQVEGQTTNLQRLAEPS
QLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEASVIPRLVQLLVKAHQDAQR
HVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASSPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDATYRPMYSSDVPLDPLEMHMDM
DGDYPMDTYSDGLRPPYPAADHMLA
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggaggtgatgaacctgatcgaacagcccatcaaggtgaccgagtggcagcagacatac
acctatgactcgggcatccactcgggggccaacacctgcgtgccctcggtcagcagcaaa
ggcctcatggaggaggacgaggcctgcgggcgccagtacacgctcaaaaagaccaccacc
tacacccaggcggtgccccaaagccaaggtgacctggagtaccagatgtccacgacggcc
agagccaagcgggtgcgggaggccatgtgtcctggtgtgacgggagaggacagctcgctg
ctgctggccacccaggtggaggggcagaccaccaacctgcagcggctggccgagccatcc
cagctcctcaagtcggccatcgtgcatctcatcaactaccaggacgacgctgagctggct
acccgggccctgcccgagctcaccaaactgctcaacgacgaggacccggtggtggtgacc
aaggcggccatgatcgtgaaccagctgtcgaagaaggaggcgtctcggcgggcgctgatg
ggctcgccccagctggtggcggccgtcgtgcgcaccatgcagaacaccagcgacctggac
acggcccgctgcaccaccagcatcctgcacaacctctcccaccaccgcgaggggctgctt
gccatcttcaagtccggcggcatccctgccctggtccgcatgctcagctcccccgtggag
tcggtcctgttctacgccatcaccacgctgcacaacctgctgctctaccaggagggcgcc
aagatggcagtgcgcctggccgacgggctgcagaagatggtgcccctgctgaacaagaac
aaccccaagttcctggccatcaccaccgactgcctgcagctcctggcctatggcaaccag
gagagcaagctcatcatcctggccaatggaggaccccaggccctcgtgcagatcatgcgc
aactatagttatgagaagctgctctggaccaccagccgcgtgcttaaggtgctgtctgtg
tgtcccagcaataagcctgccattgtggaggccggtgggatgcaggccctgggcaaacac
ctgacaagcaacagccctcgcctcgtgcagaactgcctctggaccctgcgtaacctctcg
gacgtggccaccaagcaggagggcctggagagtgtgctgaagattctggtgaaccagctg
agcgtggacgatgtcaacgtcctcacctgtgccacgggcactctgtccaacctgacctgc
aacaacagcaagaacaagacgctggtgacgcagaacagcggcgtggaggcgctcatccac
gccatcctgcgcgcgggcgacaaggatgacatcacggagcccgccgtctgcgccctgcgc
cacctcaccagccgccaccccgaggctgagatggcccagaactccgtgcgcctcaactac
ggcatcccggccatcgtcaagctgctcaatcagcccaaccagtggccactggtcaaggca
accatcggcctgatcaggaatctggccctgtgcccagccaaccacgccccactgcaggag
gcatctgtcatcccccgcctcgtccagctgctggtcaaggcccatcaggatgcccagcgc
catgtggctgcaggcacacagcagccctacacggatggcgtgaggatggaggagattgtg
gagggctgcaccggagccctgcacatcctcgcccgggatcccatgaaccgcatggagatc
ttccgactcaacaccatccccctgtttgtgcagctcctgtactcttccgtggagaacatc
cagcgtgtggccgcaggggtgctgtgcgagttggcccaggacaaggaggcggccgacgct
attgatgccgagggggcctcgtcccccctcatggagctcctgcactcccgcaatgagggc
actgccacctatgctgctgctgtcttgttccgcatctctgaggacaagaacccagattac
cgtaagcgtgtgtctgtggaactcaccaactccctcttcaagcacgaccctgcagcctgg
gaggctgcccagagcatgatccccatcaatgaaccctatgccgatgacatggatgccacc
taccgccccatgtactcaagtgatgtgcccctggaccccctggagatgcacatggacatg
gacggggactatcccatggacacctacagcgacggcctcaggcccccctaccccgctgca
gaccacatgctggcctag

DBGET integrated database retrieval system