KEGG   Sus scrofa (pig): 733650
Entry
733650            CDS       T01009                                 

Gene name
TAP2
Definition
(RefSeq) antigen peptide transporter 2
  KO
K05654  ATP-binding cassette, subfamily B (MDR/TAP), member 3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc02010  ABC transporters
ssc04145  Phagosome
ssc04612  Antigen processing and presentation
ssc05163  Human cytomegalovirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    733650 (TAP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    733650 (TAP2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    733650 (TAP2)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    733650 (TAP2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    733650 (TAP2)
   05168 Herpes simplex virus 1 infection
    733650 (TAP2)
   05163 Human cytomegalovirus infection
    733650 (TAP2)
   05169 Epstein-Barr virus infection
    733650 (TAP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    733650 (TAP2)
Transporters [BR:ssc02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    733650 (TAP2)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 AAA_16 AAA_29 AAA_30 AAA_21 AAA_23 AAA_15 SRP54 Zeta_toxin RNA_helicase AAA_33 AAA_18 RsgA_GTPase Thymidylate_kin
Other DBs
NCBI-GeneID: 733650
NCBI-ProteinID: NP_001193370
Ensembl: ENSSSCG00000025173
Vega: OTTSUSG00000001383
UniProt: A5D9J7
LinkDB
Position
7
AA seq 726 aa
MRLPDLRPWAALLLADSALLWLLQGPLEALLPRGLPGLWLEGILRLGGLWWLLRLGGLLG
YVRTLLCPLCLVIPFFLSLRALVPGALSAPPARVASAPWSWLLLGSGAAGLSWAVWAVLS
PPGAQEKKEDQENNRALMWRLLKLSWPDWPFLAAAFFFLVLAVLGETLIPYYSGLVIDIL
GGDFDPDAFVSAILFMSLFSVGSSLSAGCRGSAFTLVMSRINLRVREQLFSSLLHQDLAF
FQETKTGELNSRLSSDTKLMSLWLPLNANVLLRSLVKVLGLFGFMLSLSPRLTLLSLLQM
PLTIAAEKVYNARHLAVLREIQDAVARAGQVVREAVGDLQTVRSFGAEEEEVCRYKEALE
RCRQLWWRRDLEQALYLLLRRMLNLAMKVLLLSCGLQQILAGDLTQGGLLSFLLYQENMG
SYVHTLVYVFGDMLSNVGAAEKVFYYLDRQPDLPPPGTLAPSTLKGVVKFQGVSFAYPNC
PDQPVLKGLTFTLHPGQMTALVGPNGSGKSTVAALLQNLYQPTEGQVLLDEEPVSAYEHH
YLHQQVVLVGQEPVLFSGSVRDNIAYGLKSCSDEKVMAAARAARAEEFINEMEHGLYTDV
GEKGNQLAVGQKQRLAIARALVRDPRVLILDEATSALDAESEQALQDWKSHGNRTVLVIA
HRLHTVQNADQILVLKQGELQEHAQLMEGEDLYSYLVRQNQRPEGGTPETLPSSQGHLSD
PEELLL
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgcggctccctgacctgagaccctgggccgccctgctgctggcggactcggccttactc
tggctgctccagggacctctggaggctctgcttcctcgagggcttccaggcctgtggctg
gagggcatcttgcgacttggagggctttggtggctgctgaggctgggagggctgctggga
tatgtgcggacactgctgtgccccctctgcctggtgatccccttctttctctccttgagg
gccctggtcccaggagccttgagtgctcccccagccagagtggcttcagccccttggagc
tggctgctgctggggtccggggctgcggggctcagctgggcagtgtgggcagtgctgagc
cctccaggagcccaggagaagaaggaggaccaggagaacaacagagctttgatgtggagg
ttgctgaagctctcctggccggactggcctttcctggctgctgccttcttctttcttgtc
cttgccgtgttgggtgagacactaatcccttactattctggcctcgtgattgacatcctg
gggggtgattttgaccctgatgcctttgtcagcgccatcttgttcatgagtcttttctcc
gttgggagctcactgtccgctggctgccggggaagcgccttcaccctcgtcatgtccagg
atcaacctgcgtgtccgggagcagcttttctcctccctcctgcaccaggacctggctttc
ttccaggagactaagacaggggagctgaattcacggctgagctcggacaccaaactgatg
agtctctggcttcctctgaatgccaacgtgctcttgcgcagcctggtcaaggtgctggga
ctcttcggcttcatgctcagcttgtcgcctcgactcaccctcctctctctgctccagatg
cctctcacgatagcggctgagaaggtgtacaatgcccgccatctggcagtgcttcgagag
atccaggatgcagtggcgagagcagggcaggtggtgcgggaggctgtgggagacctgcag
actgtgcgcagttttggggccgaggaggaagaagtctgtcgctataaggaggccctggaa
cgatgccggcagctgtggtggcgaagagacctggaacaggccctctacctgctcttaagg
aggatgctgaacttggcaatgaaggtgctgttgctgagctgtgggctgcagcagatcctg
gctggggacctcacccagggtgggctgctctcctttctgctctaccaggaaaacatgggc
tcctatgtgcacaccctggtatacgtgtttggggatatgctgagcaacgtgggggctgca
gagaaggttttctactacctggacagacagccagatctgcctccacctgggacattggcc
ccttccactctgaagggggtggtgaaattccaaggcgtctcctttgcatatcctaactgc
cctgaccagcctgtgctcaagggtctcacattcaccctacatcctggtcagatgaccgct
ctggtggggcccaatgggtctgggaagagcaccgtggctgccctgctgcagaacctgtac
cagcccaccgaggggcaggtgctgctggacgaggagcccgtctccgcctatgagcatcac
tacctgcaccaacaggtggttttggtcgggcaggagcctgtgctgttctcggggtctgtg
agggacaacattgcttatgggctgaagagctgcagcgatgagaaggtgatggccgctgcc
cgggctgccagggcagaggagttcataaacgaaatggagcacggactctacacagatgtg
ggggagaaagggaaccagctggctgtgggacagaagcagcgtctggccattgcccgggcc
ctcgtgcgggacccacgagtcctcatcctggacgaggccaccagtgccctggacgcggag
agcgagcaggcgctgcaggactggaaatcccacgggaaccggacggtgctggtgatcgcg
cacaggctgcatacggttcagaacgcggaccagatcctggtgctcaagcagggagagctg
caggagcatgcgcagctcatggagggggaggacctctactcgtacctggtgcggcagaac
cagaggccggaggggggcaccccagagacactgccctcttcccagggccatctcagtgac
ccagaggagctcctgctttga

DBGET integrated database retrieval system