Sporothrix schenckii: SPSK_05721 Help Entry SPSK_05721        CDS       T05555                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism ssck  Sporothrix schenckii Pathway ssck04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:ssck00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     SPSK_05721  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ssck01009]     SPSK_05721   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssck04131]     SPSK_05721    03036 Chromosome and associated proteins [BR:ssck03036]     SPSK_05721   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssck04147]     SPSK_05721 Protein phosphatases and associated proteins [BR:ssck01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      SPSK_05721 Membrane trafficking [BR:ssck04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     SPSK_05721 Chromosome and associated proteins [BR:ssck03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      SPSK_05721 Exosome [BR:ssck04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    SPSK_05721 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EFhand_Ca_insen EF-hand_11 EF-hand_4 SPARC_Ca_bdg DUF5580_M Dockerin_1 TerB RTX_C RNA_pol_Rpb4 UPF0154 Motif Other DBs NCBI-GeneID:  27667736 NCBI-ProteinID:  XP_016583047 UniProt:  A0A0F2LWT6 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDEEVDEMIREADQD GDGRIDYNEFVQLMMQK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcaagatgaaggacaccgactccgaggaggagatccgcgaggccttcaaggtc ttcgaccgcgataacaacggcttcatctcggctgctgagctgcgccacgtcatgacgtcg atcggcgagaagctgacggacgaggaggtcgacgagatgatccgtgaggccgaccaggac ggcgacggccggattgactacaacgagttcgtccagctcatgatgcagaaataa

DBGET integrated database retrieval system