KEGG   Shewanella sediminis: Ssed_1219
Entry
Ssed_1219         CDS       T00596                                 

Definition
(GenBank) A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
sse  Shewanella sediminis
Pathway
sse03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sse00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Ssed_1219
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sse03400]
    Ssed_1219
Enzymes [BR:sse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     Ssed_1219
DNA repair and recombination proteins [BR:sse03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Ssed_1219
 Prokaryotic type
     Ssed_1219
SSDB
Motif
Pfam: NUDIX_4 HhH-GPD HHH Whib EndIII_4Fe-2S HHH_5
Other DBs
NCBI-ProteinID: ABV35830
UniProt: A8FSK7
LinkDB
Position
complement(1452845..1453957)
AA seq 370 aa
MMTNLNVPNMPPNNSTPSSSRSFSTRIVDWYDKFGRKHLPWQIDKTPYKVWVSEIMLQQT
QVSTVIPYYLKFMERFPDIQSLADAPQDEVLHHWTGLGYYARARNLHKSAQMIRDEHAGS
FPTHFEQVLALPGIGRSTAGAVLSLSLAQHHPILDGNVKRVLARHGAIEGWPGKKTVENR
LWELTDKLTPQQDVQKYNQAMMDIGASVCSRSKPACSECPVAIDCQAQLSGRQTEYPGKK
PKKMTPERNAFMLVLSKGGDTLLEKRPPAGIWGGLWCFPEFSSRQELEVYLVENGLDSAE
MEDLPGFRHTFSHFHLDITPIYIHVDDWRDNLIMEDKPSLWYNLPNPPKVGLAAATERIL
ASLGSVLIKE
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgatgacaaatttaaatgttcctaatatgccgccaaataactccacaccttccagcagc
agatctttctctacccgcatcgtcgactggtacgataaatttggccgtaaacacctgccc
tggcagatagataagaccccctataaggtatgggtatcggagatcatgctgcaacaaacc
caagttagcactgtgatcccttactatctgaagtttatggaacgttttccggacatacaa
tcactcgcggatgcaccgcaggatgaggtacttcaccactggaccgggctcggttattac
gctcgcgcacgaaatctgcataagtctgctcaaatgatccgcgatgaacacgccggtagt
tttccaacccactttgaacaggtgctggcgcttcccggcataggtcgctcgactgccgga
gcggtattatcactctcattggcacagcatcatccgatactcgacggtaacgtaaaacgc
gtgctagcccgtcacggcgctatcgaaggttggccgggaaaaaagactgtcgaaaacaga
ctctgggagttaaccgacaaattaactccgcaacaagatgtacagaaatataatcaggcc
atgatggatattggcgcttcggtttgctctcgttctaaacctgcttgttctgaatgcccg
gtagcaatcgattgtcaggctcaattatcaggcagacagaccgaatatccgggtaaaaag
cctaagaaaatgacacctgaaagaaatgccttcatgttggtcttatcaaaagggggtgac
accctgctagagaaacgtcctcctgcggggatatggggaggattatggtgcttccccgag
ttctcgagccgccaagaattagaggtatatctggtcgaaaatgggttagactcagctgaa
atggaagacttaccaggctttaggcatactttcagccactttcatctggatatcacccca
atttatattcatgtcgacgactggagagataacctgatcatggaagataagccttcactc
tggtataacttacccaatccccctaaagttggtttagctgctgcaacagagcgaattctg
gccagcttaggttctgtattaattaaggagtaa

DBGET integrated database retrieval system