KEGG   Shewanella sediminis: Ssed_1920Help
Entry
Ssed_1920         CDS       T00596                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sse  Shewanella sediminis
Pathway
sse00473  D-Alanine metabolism
sse00550  Peptidoglycan biosynthesis
sse01100  Metabolic pathways
sse01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ssed_1920
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ssed_1920
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Ssed_1920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sse01011]
    Ssed_1920
Enzymes [BR:sse01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ssed_1920
Peptidoglycan biosynthesis and degradation proteins [BR:sse01011]
 Precursor biosynthesis
  Amino acid ligase
   Ssed_1920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: ABV36531
UniProt: A8FUK8
LinkDB All DBs
Position
complement(2309461..2310462)
Genome map
AA seq 333 aa AA seqDB search
MSQTNLLLLCGGGGDEHAISLLSANFFETSLADITGFNVLRVELDADGHYHTKDGDICEL
TNRKQIRFEDESKRPWPVDYVIPCIHGYPGETGDIQSYFELINLPYFGCDSEASRNCFNK
VTAKMWFSALGIPNTPYIFLNEFNDDAISQTEQALETWGSVFIKAASQGSSVGCYRVDSI
DELASSLKEAFSYSPYVVVEKTIHARELEVAAYELDGEIVATKPGEIICASNTFYTFDEK
YAADSQAETKVEADISDELSREIREYAVKVFKGMKLSHLSRIDFFLTDENEILLNEINTF
PGLTPISMFPKMLQNHGDDFTEYLYSNIKSQLI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacgaatctacttttgttatgtggtggtggcggagatgaacacgcaatttcc
ctgctatcggcaaacttttttgaaacttcactcgccgacattactgggtttaatgtttta
cgggttgagctggatgccgatggccattatcacaccaaagatggcgacatttgcgaactg
actaaccgaaagcagataagattcgaagatgaaagcaagcgcccctggcccgttgattac
gtgatcccttgcattcatggttatcccggagaaaccggtgatattcaatcctattttgaa
ctgatcaacctgccctattttggctgtgattcagaagccagcagaaactgttttaataag
gtcacggctaagatgtggttcagtgcacttggcattcctaacaccccctatatctttctt
aacgaatttaatgacgatgcgatatctcaaactgagcaggcattagagacctggggctct
gtgtttatcaaagctgcttctcaaggttcatctgtgggttgttatcgtgtcgacagcatc
gatgagctggcgagctcattgaaggaagccttttcctactcgccttatgttgtggtcgaa
aaaaccattcacgctcgcgagctcgaagtcgctgcctatgagctggacggtgagatcgtt
gcaactaagccgggcgaaatcatctgtgccagtaataccttttataccttcgatgagaaa
tatgccgcagacagtcaggcagagaccaaggtcgaagccgatatcagtgatgaattgagc
cgagagatccgcgaatatgccgttaaggtatttaaggggatgaaactcagccatctctcc
cgcatcgacttctttctgaccgatgagaatgaaattctcctcaacgaaattaataccttc
ccgggacttacacctatttcgatgttccctaagatgctgcaaaatcatggtgatgatttt
acagaatacttatattcaaatattaagtcacaactgatctag

DBGET integrated database retrieval system