KEGG   Shewanella sediminis: Ssed_2780Help
Entry
Ssed_2780         CDS       T00596                                 

Definition
(GenBank) pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sse  Shewanella sediminis
Pathway
sse00250  Alanine, aspartate and glutamate metabolism
sse00410  beta-Alanine metabolism
sse00430  Taurine and hypotaurine metabolism
sse00650  Butanoate metabolism
sse01100  Metabolic pathways
sse01110  Biosynthesis of secondary metabolites
sse01120  Microbial metabolism in diverse environments
sse02024  Quorum sensing
Module
sse_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Ssed_2780
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ssed_2780
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ssed_2780
   00430 Taurine and hypotaurine metabolism
    Ssed_2780
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Ssed_2780
Enzymes [BR:sse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Ssed_2780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: ABV37387
UniProt: A8FX14
LinkDB All DBs
Position
3352760..3354412
Genome map
AA seq 550 aa AA seqDB search
MTARQAKASEEALLRIFTIPEAPGSTLSVIEQNISQNLMGFLQESVVAVEKPLTEIERDF
QEHQIPAAPKFVSDYADEMMKTLVAHSVHTSAPSFIGHMTSALPYFVLPLSKMMVGLNQN
LVKIETSKAFTPLERQVLGMMHHLIYDENETFYNSWMHSANVSLGAFCSGGTVANITALW
TARNQLLKADGDFKGIAAQGLMKGLRHYGYNDLAILVSERGHYSLGKTADLLGIGRENII
QIPTSNDNRVDVDKMRVTAKALERDNIKVMAIVGVAGTTETGNIDPLDKLATLAEELDCH
FHVDAAWGGASLLSKKYRHLLKGIERADSVTIDAHKQMYVPMGAGMVIFKDPTFANAIKH
HAEYILRKGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAELIK
TTDNFELVSEPELCLLTYRYVPESVQKAMQQARTDGDIERLLQFNRLLDGLTKFVQKRQR
EQGTSFVSRTRINPEHCHDIDVDLKSVVFRVVLANPLTTNEILQQVLVEQTQIASTDKKF
LPQLLELAAH
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaagacaagcaaaagcttccgaagaggcgttactacgtattttcactatcccc
gaagccccaggttcaaccctgagcgtcattgaacaaaatatctcgcaaaacttaatggga
ttcttgcaagagagcgtggttgcggtcgaaaagccgttaaccgaaatagaacgcgacttt
caggaacatcaaatccccgctgcccctaagtttgtctcagattatgccgatgagatgatg
aaaaccttagtggcgcactcggtgcacacctcggcccccagcttcatcggccatatgacc
tcggcgctgccctattttgtattgcctctgtccaagatgatggtgggactcaatcaaaac
ctggttaaaattgaaacctcgaaggcctttacgccactcgaacgtcaggttttgggcatg
atgcatcacctcatctacgatgagaatgaaacgttttacaatagctggatgcacagcgca
aacgtctccctcggcgcattttgctccggcggaaccgtagctaacatcacggccttgtgg
actgcccgtaaccagctattaaaagccgatggcgactttaaaggcatcgcggctcagggg
ctgatgaaggggttacgccattatggttacaacgatttagccattctcgtctccgagcgt
ggccactactctttgggtaaaaccgccgatctactcggtattggccgggaaaacatcatt
caaatacccacatccaatgacaaccgggtggatgtggataagatgcgtgtcacggctaag
gcgcttgagcgtgacaatattaaggtcatggcgatagtgggcgtagccggcaccacagag
acaggtaatatcgaccccttagataagctggccacattggcagaagagctggactgtcac
ttccatgtcgatgcggcttggggcggtgcatccttgctatccaagaaataccgtcacctg
cttaaagggatagagcgcgccgactcggtgaccatagatgcccacaaacagatgtatgtg
cccatgggcgccggcatggtgatcttcaaagaccccaccttcgccaatgctatcaagcat
cacgccgagtacattctgcgtaaaggctcaaaagatctcggtagtcagactctggaggga
tctcgtccgggtatggcgatgttagtccacgcctgtttgcagataatcgggagagacggc
tatgagatcctgatcaataacagcctggaaaaagcccgttattttgccgaactcatcaag
acgacagataattttgaactggtgtcagaacctgagttgtgtctgctgacctatcgatat
gttcctgagtcggtgcaaaaggctatgcaacaagcaagaaccgatggcgatattgagcga
ttattgcagtttaatcgcctgctcgatggattaactaagtttgtgcagaaacgtcaacgt
gagcaaggcacctccttcgtctcccgtacccgtattaatcctgaacactgccatgacata
gatgtcgatctgaaatccgtggtatttcgcgtcgtgctggcaaatccattgacgaccaat
gaaattctacaacaggtactcgtcgaacagacgcagatcgcctcgacagataaaaaattc
ttgccccagttgctggaactggccgctcattga

DBGET integrated database retrieval system