KEGG   Solibacillus silvestris DSM 12223: SOLI23_17120Help
Entry
SOLI23_17120      CDS       T04506                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ssil  Solibacillus silvestris DSM 12223
Brite
KEGG Orthology (KO) [BR:ssil00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SOLI23_17120
Enzymes [BR:ssil01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SOLI23_17120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 Thi4 DAO NAD_binding_8 NAD_binding_7 Glutaredoxin FMO-like AlaDh_PNT_C K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AMO87753
UniProt: A0A1A7M0R3
LinkDB All DBs
Position
complement(3483654..3485165)
Genome map
AA seq 503 aa AA seqDB search
MLEGDLLIKVSVNDDKTSQEMLNLVEELEKMSPRITVQHALLERTPSFSINKVGEGESGI
TFAGLPLGHEFTSLVLALLQVSGRAPKIDAAVVKRIQAIKQPLKFETYVSLTCHNCPDVV
QALNIMAVLNPNISNTMVEGGAFQSEIKERDIMAVPTVYLNGENFGGGRMELEDILTKLG
EVSDGSEFADKEAFDVLVVGGGPAGSAAAIYSARKGIRTGIVADRFGGQVNDTLSIENII
GTKATEGPAFVSSLEAHVLDYDIDVMKSQRAAKIEKKDFIEVTLENGAVLKGKTVILSTG
ARYRQLEVPGEEEFKNKGVAYCPHCDGPIFKGKDVAVIGGGNSGVEAAIDLAGIVNHVTL
IQRNSELKADKVLQERVYSLKNVTVITNALTTEITGTDKVNGLMYKDVATGEEKHIELQG
VFIQIGLLPNTEFLKGTVNMNAHGEIIVDNHGATNIPGVFAAGDCTDTVYKQIVISMGSG
ATAALGAFDYMIRNVDSRDFVKA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaggtgatttattaattaaagtgagtgttaatgacgacaagacatcgcaagaa
atgctcaatttagttgaagagttggaaaagatgtctcctcgtattacggtgcaacatgct
ttattagaacgtacaccaagtttcagtattaataaagtaggcgaaggagaatctggtatt
acatttgccgggttaccacttggtcatgaatttacatcattagttttagcgcttttacaa
gtttcaggacgtgcaccaaaaattgatgcagcagttgtaaagcgtattcaggcgatcaaa
cagccgttgaagtttgaaacgtatgtaagtttaacttgtcacaactgcccggatgtagtg
caggcgttaaacattatggcggttttaaatccgaatatctcgaacacgatggtcgaaggt
ggagcattccaatctgaaattaaagagcgagatattatggcggtgcctactgtatattta
aacggcgaaaacttcggtggtggtcgtatggagctggaagatattttaacaaagttaggt
gaagtatcagacggctcggaatttgcagataaagaagcttttgatgtattagtagtaggt
ggcggtcctgccggttctgcagccgctatttattcggcgcgtaaagggattcgtacaggt
attgtagccgatcgcttcggtggtcaggttaacgatacgttatcgatcgaaaacattatt
ggaacaaaggcaacagaaggtccggcatttgtatcaagcttagaagcgcatgtattagac
tatgatatcgatgtgatgaaatcccaacgtgctgcaaagatcgagaaaaaagattttatt
gaagtaacgttagaaaatggcgcggtattaaaagggaaaacagttatcctttctacgggt
gctcgttatcgtcaactagaggtgcctggtgaggaagaatttaaaaataagggtgttgcg
tattgtccgcattgtgacggtccgatttttaaagggaaagatgtagcggtaatcggtggc
ggtaactctggtgtagaagcggctatcgacctagcgggtattgtaaatcatgttacgcta
atacagcgtaacagtgagttgaaggcggataaagtgttacaagagcgcgtttacagttta
aaaaacgttacagtcattacgaatgctttaactactgaaattacaggaacggataaagtg
aatggtttaatgtataaagacgttgctactggtgaagaaaagcatattgaattacaaggt
gtattcattcaaattggtttattgccaaatacagagttccttaaagggacggtaaacatg
aatgcgcatggtgaaattattgtagataaccacggggctacaaatattccgggagtcttt
gctgcaggtgattgcacggatacggtgtataagcaaattgtcatttcaatgggttctggc
gcaacagcagctttaggggcatttgactatatgattcgaaatgttgattcacgtgatttt
gtaaaagcataa

DBGET integrated database retrieval system