KEGG   Sclerotinia sclerotiorum: SS1G_00699Help
Entry
SS1G_00699        CDS       T01071                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SS1G_00699
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SS1G_00699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 5494919
NCBI-ProteinID: XP_001598610
UniProt: A0A1D9PZK6 A7E5X4
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVKAVATVRGDSKVSGTVTLEQADESSPTIISWNISGNDANAERGMHIHQFGDNTNGCTS
AGPHFNPHGQTHGAPTDEVRHVGDLGNFKTDAQGNATGSVEDSQIKLIGPLSVIGRTVVV
HSGTDDLGRGDTEESKKTGNAGTRPACGVIGIAA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagcagttgctaccgtccgaggtgactccaaggtctccggtaccgtcactctc
gagcaagctgacgagtcttccccaaccatcatctcatggaacatctctggaaacgacgca
aacgctgagcgtggcatgcacattcatcaattcggtgacaacactaacggttgcacatct
gccggtcctcatttcaacccacacggtcaaacccatggtgctcctaccgatgaggtccgc
catgtaggtgacctcggaaacttcaagactgatgctcaaggaaatgccactggttccgtt
gaagatagtcagattaagttgattggcccattgagtgtcattggacgtaccgttgttgtc
cactccggaactgatgacctcggcagaggagacactgaagagtccaagaagaccggtaac
gccggaaccagaccagcttgtggtgttattggtattgctgcataa

DBGET integrated database retrieval system