KEGG   Sclerotinia sclerotiorum: SS1G_03823
Entry
SS1G_03823        CDS       T01071                                 

Definition
(RefSeq) predicted protein
Organism
ssl  Sclerotinia sclerotiorum
SSDB
Motif
Pfam: RNA_ligase
Other DBs
NCBI-GeneID: 5491861
NCBI-ProteinID: XP_001595734
UniProt: A7EET3 A0A1D9QC67
LinkDB
Position
Unknown
AA seq 647 aa
METNKDTLYPKISAKPKNLMLEFSKYQKKTKGRQASSILVTGTVKLHGTHTDFLIHANDT
IQFQTRNNENFTADMDTIGFMPFAQMLKPQILHLKKQIHARFSTLNPKAKLDDAHPLIIA
GEFIGPKIQKDVAISALPRKCFVIISVSINNEWQPDEQYADIHNESVGVFNVSRGGFFHE
TITIKNPQPAFEKMQALADAVEKECPFAKSFGIIGLGEGIVWKPTVPLCHDAKYWLKLKG
PISMGTAVAGPTARIPQRSGFVTPSFSKATPANGGAPSRATGNTTQHRGDFVVSASPPLK
PAEASKGSPNHSDNMLSSQSPHSRHPLSEINPTLWKSKNVTVGTPRNSKPGQIIAPVALA
PGKVNVAPSENSRPNQGARPALVLAGDENRSLESPKNMEGSISPGFKKAEGGALVSRKFT
ESTKSTQLTPEMIQQARSEIIDLIQTGGSVASSMTRYKVDELAPKISSAVESITSSPATS
EGSSREPSESEDEIQAGWPLPLLFKRANDADPEDAKSTPLTLILEKFDEMSLKTFKPIHL
PLKFKTVEIPVLAAARSFAYEVAWDRRLEQAWQFLCENQAPRDRNGIVVFLKWLYHDIAV
EEKAEIEEMKIDRHFLKKEIEIIGREWYFEELLFKEHDWNFNTGAEL
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggaaaccaataaggatacactatatccgaaaatatccgcgaaaccaaagaacctaatg
ctggagtttagcaagtatcagaaaaagacgaaaggtcgacaggctagcagcatcttggtc
actggtaccgtgaagctacacggaacgcatactgacttcctgatccatgcaaatgatacc
attcagtttcaaactcgcaacaacgaaaactttacggcggatatggataccatcggcttc
atgccttttgcccaaatgctaaaaccacaaattttgcatttgaaaaagcaaatccatgct
agattttcaacactaaaccctaaggcaaaattggacgatgcacatccgctcattatcgct
ggagagtttattggtcccaagattcaaaaagatgtggctattagtgcactccctcgaaaa
tgcttcgtgatcatttctgtctccatcaacaatgaatggcagccggatgagcaatacgcc
gatatccacaacgaatccgtcggtgttttcaatgtctctcgaggagggtttttccacgag
acgattactatcaagaatccacagccagcatttgagaagatgcaagcactagctgatgca
gtagaaaaagaatgtcctttcgccaaatctttcggaatcatcgggctaggtgagggcatt
gtctggaaacccaccgtgcctctttgtcacgatgctaaatattggttgaagctaaaagga
ccgatatcaatggggactgctgtggctggaccaacggctagaattccgcaacgaagcggc
tttgtgacgccgagtttttcaaaagcaacacctgcaaatggtggtgcaccttctagagca
acgggcaacacaactcaacatcgtggggatttcgtagtttctgcgtctccacccttgaaa
ccagctgaggcaagcaagggttctccaaaccactcggacaacatgttatcatcacaaagt
ccacattcaagacatccactttccgagataaaccctaccctatggaagagtaagaatgtc
acagttggaaccccacggaattcgaagcctggtcagattatcgctcccgtcgcattggca
ccagggaaagtcaatgtggctccatcagagaattcaagaccaaatcaaggcgccaggcct
gcactagtacttgcaggagacgaaaatcgcagcctagaaagccccaagaacatggaaggc
tctatatccccgggattcaagaaagccgaaggaggtgccctagtgagccgaaaatttact
gagagtaccaaatcgacacaattaacacctgagatgatccaacaagcaagatcggaaatt
atagaccttatccagaccggcgggtctgtggcatcatcaatgacacgttataaggtggac
gagcttgcgccgaaaatttctagcgctgttgagagtattacctcctctccagccacgtcg
gaggggtctagtagagaaccttcggagagcgaagacgagattcaagctggttggccgctt
ccattgctctttaaacgggccaatgatgcagatccagaagatgcaaaatctactcccctg
acgctgattctagagaagtttgacgagatgtcattgaagacctttaagccaattcattta
ccattaaaattcaagacggttgaaataccagtattggcagcagctagatcattcgcatat
gaagtagcctgggatagaaggttggagcaggcctggcaattcctttgcgagaatcaggct
ccaagagataggaacggcatagtggttttcttgaaatggttgtaccacgacattgcagta
gaggagaaggcagagattgaagaaatgaagatcgataggcatttcttaaagaaggagatt
gagataatcggtagagagtggtatttcgaggagctattatttaaggagcatgattggaac
tttaatactggggcggagctttga

DBGET integrated database retrieval system