Sclerotinia sclerotiorum: SS1G_13465 Help Entry SS1G_13465        CDS       T01071                                  Name (RefSeq) predicted protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism ssl  Sclerotinia sclerotiorum Pathway ssl00510   N-Glycan biosynthesis ssl00513   Various types of N-glycan biosynthesis ssl01100   Metabolic pathways ssl04141   Protein processing in endoplasmic reticulum Module ssl_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ssl00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     SS1G_13465    00513 Various types of N-glycan biosynthesis     SS1G_13465  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     SS1G_13465 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost4 SVA Motif Other DBs NCBI-GeneID:  5481610 NCBI-ProteinID:  XP_001585581 UniProt:  A7F785 LinkDB All DBs Position Unknown AA seq 58 aa AA seqDB search MISDDELYRLAIFLGSAAMLLIVLYHILEVNSAEEPKSDNKVSSTSTSQDSKANVANR NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atgatctctgacgatgaactctaccgcctcgccatcttccttggctcagccgcaatgctt ctaatcgtcctttaccacattctcgaagtcaactctgcagaagagcccaaatcagacaac aaagttagctcaacttccacatctcaagacagcaaagcaaacgtggcaaatagatga

DBGET integrated database retrieval system