KEGG   Shigella sonnei Ss046: SSON_P084
Entry
SSON_P084         CDS       T00274                                 

Gene name
ipaJ
Definition
(GenBank) IpaJ
  KO
K23832  cysteine protease IpaJ [EC:3.4.22.-]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SSON_P084 (ipaJ)
Enzymes [BR:ssn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     SSON_P084 (ipaJ)
SSDB
Other DBs
NCBI-ProteinID: AAZ91104
ShiBASE_China: SSOP084
UniProt: Q3YTQ8
LinkDB
Position
pSS_046:77287..78066
AA seq 259 aa
MSEQRKPCKRGCIHTGVMLYGVLLQGAIPREYMISHQTDVRVNENRVNEQGCFLARKQMY
DNSCGAASLLCAAKELGVDKIPQYKGSMSEMTRKSSLDLDNRCERDLYLITSGNYNPRIH
KDNIADAGYSMPDKIVMATRLLGLNAYVVEESNIFSQVISFIYPDARDLLIGMGCNIVHQ
RDVLSSNQRVLEAVAVSFIGVPVGLHWVLCRPDGSYMDPAVGENYSCFSTMELGARRSNS
NFIGYTKIGISIVITNEAL
NT seq 780 nt   +upstreamnt  +downstreamnt
atgtcggaacaacggaagccttgcaaacggggatgtattcatacaggtgttatgttatat
ggggttttattgcagggggctataccaagagaatatatgatatctcatcagactgatgtg
agggtaaatgagaatagagtaaacgaacaaggttgttttttggcgaggaagcagatgtat
gacaattcttgtggagctgccagtttactctgtgctgcaaaggaattaggggttgataaa
ataccacaatacaaagggtctatgtccgaaatgacaaggaagagttctcttgatttggat
aatcgttgtgagcgggatttatacttaataactagtggtaattataatccgagaatacac
aaagataatatcgcggatgccggttattctatgcctgataagatagtcatggctacgagg
cttcttggattgaatgcttatgtcgttgaagaaagtaacattttttcgcaagtaattagt
tttatttatcccgatgcaagggacttattaattggcatgggatgtaatatagtacatcaa
cgagatgtgttatcttctaaccaaagagttttggaagctgttgctgtatcctttattgga
gttcctgtcggcctccactgggtgttgtgtagacctgatggaagctatatggatccagct
gtaggagaaaattattcttgtttttcaactatggaattaggtgcaagaagaagtaattct
aactttataggatatactaaaataggtatttccatagttataactaatgaggctttgtaa

DBGET integrated database retrieval system