KEGG   Shigella sonnei Ss046: SSON_P241
Entry
SSON_P241         CDS       T00274                                 

Gene name
icsP_sopA
Definition
(GenBank) IcsP/SopA
  KO
K13520  outer membrane protease [EC:3.4.23.-]
Organism
ssn  Shigella sonnei Ss046
Pathway
ssn05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SSON_P241 (icsP_sopA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssn01002]
    SSON_P241 (icsP_sopA)
Enzymes [BR:ssn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     SSON_P241 (icsP_sopA)
Peptidases and inhibitors [BR:ssn01002]
 Aspartic peptidases
  Family A26: omptin family
   SSON_P241 (icsP_sopA)
SSDB
Motif
Pfam: Omptin
Other DBs
NCBI-ProteinID: AAZ91259
ShiBASE_China: SSOP241
UniProt: Q3YTA4
LinkDB
Position
pSS_046:213078..214025
AA seq 315 aa
MKLKFLVLALCVPAIFTTHATTNYPLFIPDNISTDISLGSLSGKTKERVYHPKEGGRKIS
QLDWKYSNATIVRGGIDWKLIPKVSFGVSGWTTLGNQKASMVDKDWNNSNTPQVWTDQSW
HPNTHLRDANEFELNLKGWLLNNLDYRLGLIAGYQESRYSFNAMGGSYIYSENGGNRNKK
GAHPSGERTIDYKQLFKIPYIGLTANYRHENFEFGAELKYSGWVRSSDTDKHYQTETIFK
DEIKNQNYCSVAANIGYYVTPSAKFYIEGSRNYISNKKGDTSLYEQSTNISGTIKNSASI
EYIGFLTSAGIKYIF
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaaattaaaattccttgtacttgcactttgtgtaccagcgatctttactacacatgct
accactaactatccacttttcataccggacaacatcagtacggatattagtctaggatct
ctgagtggcaaaacaaaagaacgcgtttatcatcccaaggaaggggggagaaaaattagt
caactggactggaaatacagtaatgcgactattgttagaggtggcatcgattggaagcta
attccaaaagtgtctttcggagtttccggttggactactttaggtaaccagaaagcaagc
atggttgataaagactggaacaattccaatacccctcaggtatggaccgaccagagctgg
catcccaatacgcatctccgtgatgctaacgaattcgagctgaatcttaaaggttggtta
ttaaataatttggattatcgacttggactaatagcaggttaccaagagagtcgttacagt
tttaatgcaatgggagggagttatatttatagtgaaaacggggggaacaggaataaaaaa
ggggcacatcctagtggtgaaagaacaatagattacaaacagctcttcaaaataccttat
attggattaactgctaattaccgccatgagaattttgagtttggagcagaactgaaatat
agtggttgggttcgttcatctgatacagataaacactatcagactgagacaatttttaaa
gatgaaataaaaaaccaaaattactgctctgttgctgcgaatattggatactatgtcacc
cccagtgcaaaattttatatagaaggctccagaaattacatttctaataaaaaaggtgat
acatctctttatgagcaaagtaccaatatatctggcaccattaaaaatagtgcaagtatt
gaatatattggttttctcacttccgcaggtataaagtatattttttga

DBGET integrated database retrieval system