KEGG   Streptomyces sp. SirexAA-E: SACTE_4042Help
Entry
SACTE_4042        CDS       T01601                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00564  Glycerophospholipid metabolism
ssx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SACTE_4042
Enzymes [BR:ssx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SACTE_4042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 GMC_oxred_N 3HCDH_N GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEN11885
UniProt: G2NFB4
LinkDB All DBs
Position
4465193..4466899
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAERAEALAAMAERELDVLVVGAGVVGAGTALDAATRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSVSSGHGRGLPMHRHLSRRHALRVAPALRKDALVGALQYYDAQMDDARY
VATLVRTAAGYGAHVANQARVTGFLREGERVVGVRVEDVEGGGEYEVRAKQVVNATGVWT
DDTQALIGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKTHPAASSADIDYLLEHVNSVLNVPLSRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVAQCVTEDVPLLGAEGYHAL
WNARARIASRTGLHVVRVEHLLNRYGSMAEEVLDLVEADAALGEPLAGAEDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRCARECADLMAPVLGWDTSQVEREVEHYRKRV
EAERESQRQPDDLTADAARLGAPDIVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactgggacccgcggagcgcgccgaggcgctggccgcgatggccgag
cgcgaattggacgtgctggtcgtgggggcgggcgtggtcggcgccgggaccgcgctggac
gccgccaccagaggactctcgaccggcctcgtcgaagcgcgtgactgggcctcggggacg
tccagcaggtcgagcaagctgatccacggcgggttgcgctatctggagatgctggacttc
gcgctcgtgcgggaggcgctgaaggagcgcgggctgctcctggagcggctggccccgcac
ctggtgaagcccgtcccgttcctctacccgctgcagcacaaggggtgggagcggctgtac
gcgggctcgggcgtcgcgctgtacgacgcgatgtcggtgtcctcgggccacggccgcggg
ctgcccatgcaccggcacctctcgcgccgccacgccctgcgcgtcgcgccggccctccgc
aaggacgccctggtcggcgccctccagtactacgacgcgcagatggacgacgcccgctac
gtggcgaccctggtccgcaccgccgcgggctacggcgcgcatgtggcgaaccaggcccgg
gtgaccggcttcctccgggagggcgagcgggtcgtcggcgtacgcgtcgaggacgtcgaa
ggcggcggcgagtacgaggtgcgggccaagcaggtggtcaacgcgaccggggtgtggacg
gacgacacccaggcgctcatcggggagcgcgggcagttccacgtccgggcgtccaagggc
atccacctcgtcgtgccgaaggaccgcatccactccacgaccgggctgatcctgcggacc
gagaagtccgtcctcttcgtgatcccgtggggccggcactggatcatcggcaccaccgac
accgactgggacctggacaagacgcacccggccgcctccagcgccgacatcgactacctg
ctcgaacacgtcaactcggtgctgaacgtcccgctgagcagggacgacgtcgagggcgtc
tacgcggggctgcggcccctcctggccggtgagtcggacgcgacgagcaagctctcacgg
gagcacacggtggcccatccggtgccggggctcgtcgtcgtggcgggcggcaagtacacg
acgtaccgggtgatggcgaaggacgccgtggacgaggcggtgcacgggctggaccagcgc
gtggcccagtgcgtcacggaggacgtgccgctgctgggtgccgaggggtaccacgccctg
tggaacgcccgggcgaggatcgcctcccggacgggtctgcacgtcgtccgggtcgagcat
ctgctcaaccggtacggctcgatggccgaggaggtgctcgacctcgtggaggccgacgcg
gcgctcggcgaaccgctggccggggcggaggactacctgcgggcggaggtcgtctacgcc
gcctcgcacgaaggcgcccgccatctcgacgacgtactgacccggcggacccggatctcc
atcgagaccttcgaccggggcacccggtgcgcccgggagtgcgcggacctgatggcgccg
gtgctgggctgggacaccagccaggtcgagcgggaggtggagcactaccgcaagcgggtc
gaggcggagcgggagtcgcagcggcagcccgacgacctgacggcggacgcggcgcggctg
ggggcgccggacatcgtgccgctctga

DBGET integrated database retrieval system